(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE507

PENCW_13.PE507       Location/Qualifiers
FT   CDS             join(1199924..1200552,1200606..1200762,1200936..1200962)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948806"
FT                   /orf_name="Pc16g05070"
FT                   /product="Putative uncharacterized protein Pc16g05070 "
FT                   /protein_id="CAP93177.1"
FT                   /db_xref="UniParc:UPI0001831B24"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B5"
FT                   /transl_table=1
FT                   /translation="MSREVDIVPLIGHCVPYVAIILYHTRRQVRIYSTTFSKHKAFLFI
FT                   HIGTGIMELARYHISKARLGNENVLPEVIDVLSCLIWSWASFVLVKTLRRGDPLTTRPP
FT                   YQVAAALRPVICIASYMLQLPSLHRISISALDSFVYARMAIFFFTYTPYLRGYSYSTIY
FT                   SLSIPLAAVVSIHESHVRGATLVFMLATAYVAKLNEWVTHRSRIVQRSETKSAMDMLEK
FT                   HVLAGLLLLGFAELDRLREVSKNDALTKPLNDDYVPKLEHVFIYKVRS"
     MSREVDIVPL IGHCVPYVAI ILYHTRRQVR IYSTTFSKHK AFLFIHIGTG IMELARYHIS        60
     KARLGNENVL PEVIDVLSCL IWSWASFVLV KTLRRGDPLT TRPPYQVAAA LRPVICIASY       120
     MLQLPSLHRI SISALDSFVY ARMAIFFFTY TPYLRGYSYS TIYSLSIPLA AVVSIHESHV       180
     RGATLVFMLA TAYVAKLNEW VTHRSRIVQR SETKSAMDML EKHVLAGLLL LGFAELDRLR       240
     EVSKNDALTK PLNDDYVPKL EHVFIYKVRS                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page