(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE510

PENCW_13.PE510       Location/Qualifiers
FT   CDS             join(complement(1206674..1207477),
FT                   complement(1205736..1206626))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824618"
FT                   /orf_name="Pc16g05100"
FT                   /product="Pc16g05100 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP93180.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831B27"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9B8"
FT                   /transl_table=1
FT                   /translation="MSLYPNRHRLALFSLKPLNEQAKKVANHPYNQHLTSSLPDGTRVL
FT                   DIGFQVRSRSNRTLATLGRGDADIFVDGPTIAKVQCSFEIEPATNVVMLYDRSHGQTTQ
FT                   VFGDDATPFEPGRLRQVVVQKGLNSFLGMGGRAQNTVQFEFLWYQDFPEMVGLIKDRES
FT                   IMNDCEENPRLARTADDVETVLPSQMQTRIHTAGPRQLTMRYLKFGKLGSGQFAVVYKA
FT                   LDVDTGKFLAVKIIQRPEQASAQAAWEVSKYYALKREVEHLSRISHPHIVDFITSQGWE
FT                   GPTAEIFMGLKDGTLESLVKGGVPDVESIAKRAFYQMLQALDCLAANGIVHRDVKPENI
FT                   LYTVLPGMQYHFQLGDFGLSNRAIVAKSSVGTPLYMAPEVYEHGVQTHKMDVWSLFVTF
FT                   AWVSDFDGFRQNLHHFTSLPQAREAILAMASRIGAMQEMARVNPDERASAAQILVKVYN
FT                   GEGLTTQLNRIPPLTPTVVETRPEPQLQPEPMHQVRHRPTQGMPKFPKPHTSQFRVRKS
FT                   SNPRGRIWEPNTTAARPGGNLPPTRRRRHPSNVEFLQGFRMRPPLNY"
     MSLYPNRHRL ALFSLKPLNE QAKKVANHPY NQHLTSSLPD GTRVLDIGFQ VRSRSNRTLA        60
     TLGRGDADIF VDGPTIAKVQ CSFEIEPATN VVMLYDRSHG QTTQVFGDDA TPFEPGRLRQ       120
     VVVQKGLNSF LGMGGRAQNT VQFEFLWYQD FPEMVGLIKD RESIMNDCEE NPRLARTADD       180
     VETVLPSQMQ TRIHTAGPRQ LTMRYLKFGK LGSGQFAVVY KALDVDTGKF LAVKIIQRPE       240
     QASAQAAWEV SKYYALKREV EHLSRISHPH IVDFITSQGW EGPTAEIFMG LKDGTLESLV       300
     KGGVPDVESI AKRAFYQMLQ ALDCLAANGI VHRDVKPENI LYTVLPGMQY HFQLGDFGLS       360
     NRAIVAKSSV GTPLYMAPEV YEHGVQTHKM DVWSLFVTFA WVSDFDGFRQ NLHHFTSLPQ       420
     AREAILAMAS RIGAMQEMAR VNPDERASAA QILVKVYNGE GLTTQLNRIP PLTPTVVETR       480
     PEPQLQPEPM HQVRHRPTQG MPKFPKPHTS QFRVRKSSNP RGRIWEPNTT AARPGGNLPP       540
     TRRRRHPSNV EFLQGFRMRP PLNY                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page