(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE512

PENCW_13.PE512       Location/Qualifiers
FT   CDS             join(complement(1211048..1211391),
FT                   complement(1210841..1210981),complement(1210188..1210773))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948809"
FT                   /orf_name="Pc16g05120"
FT                   /product="Pc16g05120 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP93182.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniParc:UPI0001831B29"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9C0"
FT                   /transl_table=1
FT                   /translation="MSRFTVPPGDQTVQVRIIDSTTRIDNFQLGFLMEPPMDGMEYMSP
FT                   LPSWSFLIEHPSGQKILYDLGTRKDLNSFAPTVCEHLKAQGWKVDVKEEVIDTLDKNGI
FT                   AATGISAIIWSHWHWDHIGDLSRFPSSTELIVGPGFKAEFLPGYPARPDAHILESDFAG
FT                   RNLREIDFSNSVQVGQFRAIDFFGDGSFYILDSPGHAVGHLGALARTTTNPDTFIFMGG
FT                   DLCHHSGEIRPSKHLPISRDIQPRLATPIPLQCPGDWVYEQLLVRRTGSADKPFFLPAM
FT                   GLDIEKAIETIEKAQVADADNNIWFIYAHDRSLLGCVDLFPLPANAWKEKNWREKTLWT
FT                   FLGEFETAIKQIEYHS"
     MSRFTVPPGD QTVQVRIIDS TTRIDNFQLG FLMEPPMDGM EYMSPLPSWS FLIEHPSGQK        60
     ILYDLGTRKD LNSFAPTVCE HLKAQGWKVD VKEEVIDTLD KNGIAATGIS AIIWSHWHWD       120
     HIGDLSRFPS STELIVGPGF KAEFLPGYPA RPDAHILESD FAGRNLREID FSNSVQVGQF       180
     RAIDFFGDGS FYILDSPGHA VGHLGALART TTNPDTFIFM GGDLCHHSGE IRPSKHLPIS       240
     RDIQPRLATP IPLQCPGDWV YEQLLVRRTG SADKPFFLPA MGLDIEKAIE TIEKAQVADA       300
     DNNIWFIYAH DRSLLGCVDL FPLPANAWKE KNWREKTLWT FLGEFETAIK QIEYHS           356
//

If you have problems or comments...

PBIL Back to PBIL home page