(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE513

PENCW_13.PE513       Location/Qualifiers
FT   CDS             join(complement(1213093..1213630),
FT                   complement(1212990..1213043),complement(1212659..1212932),
FT                   complement(1211752..1212568))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671913"
FT                   /orf_name="Pc16g05130"
FT                   /product="Pc16g05130 protein"
FT                   /protein_id="CAP93183.1"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniParc:UPI0001831B2A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9C1"
FT                   /transl_table=1
FT                   /translation="MLLSKTLLGSILGFAVSSTARIIATDEVPLLGPSFLSNFDPSNST
FT                   AISHAKSEFPGLIDNLFSTGALNRTDLAFHIDVFSASTNKSIYSYSHVGENSKKSVTSG
FT                   ELNDKTISRLGSVTKLFTVYAIIAKAGIEVFSDPVTKYLPELAGNPAYDPLESIRWEDI
FT                   TVGALASQQAGSGGAADFLKHYLDPERPLQYSAEDLLKFFRDEKKPVISPFRNAVYSDG
FT                   GFAILGQVLARLSGKTYSEAVQEILFDPLELESMSTKVPTGPDLNVIDRRIIDKNTSWG
FT                   VDVEVIASTGSYYSNAADLRTAGLAILNSELLSPATTSQWMKPSSGTGSLVELVGAPWE
FT                   ISRLEIPVTPGSNRTRISDLYTKAGGNIDYTAIFALSPDHGIGYSILVAGFTATPARWP
FT                   LRDVVGETFIPAAEHAAAENAKRNLAGTFADQTSPDTNLTLSVDRGRPGLGLKSFWVKG
FT                   TNARDHAHWRLYPTGLNSFSKSLSSLYKAKGSVRVAHRMVQPQTPVKPRAAVEGGKGGL
FT                   FDNSFVWMNLDFAGPSDEFIFNLVDGRLVSVEYPTTGSVLRRV"
     MLLSKTLLGS ILGFAVSSTA RIIATDEVPL LGPSFLSNFD PSNSTAISHA KSEFPGLIDN        60
     LFSTGALNRT DLAFHIDVFS ASTNKSIYSY SHVGENSKKS VTSGELNDKT ISRLGSVTKL       120
     FTVYAIIAKA GIEVFSDPVT KYLPELAGNP AYDPLESIRW EDITVGALAS QQAGSGGAAD       180
     FLKHYLDPER PLQYSAEDLL KFFRDEKKPV ISPFRNAVYS DGGFAILGQV LARLSGKTYS       240
     EAVQEILFDP LELESMSTKV PTGPDLNVID RRIIDKNTSW GVDVEVIAST GSYYSNAADL       300
     RTAGLAILNS ELLSPATTSQ WMKPSSGTGS LVELVGAPWE ISRLEIPVTP GSNRTRISDL       360
     YTKAGGNIDY TAIFALSPDH GIGYSILVAG FTATPARWPL RDVVGETFIP AAEHAAAENA       420
     KRNLAGTFAD QTSPDTNLTL SVDRGRPGLG LKSFWVKGTN ARDHAHWRLY PTGLNSFSKS       480
     LSSLYKAKGS VRVAHRMVQP QTPVKPRAAV EGGKGGLFDN SFVWMNLDFA GPSDEFIFNL       540
     VDGRLVSVEY PTTGSVLRRV                                                   560
//

If you have problems or comments...

PBIL Back to PBIL home page