(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE515

PENCW_13.PE515       Location/Qualifiers
FT   CDS             join(1215338..1215389,1215447..1216282)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20671914"
FT                   /orf_name="Pc16g05150"
FT                   /product="Pc16g05150 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93185.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0001831B2B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9C2"
FT                   /transl_table=1
FT                   /translation="MARVLEGKFGIVTGGSRGIGEAIARNLAEKGCSLLLNFTSESSRA
FT                   PTEALCSSLATTHNIKCESVQADLSKPAEAVTAIITAAKERFSTSGKFQIDILINNAGV
FT                   SQDRNLNDANKGPIEAEHFNWQYSINVLAPLLLTQACAPFLPTDRSGRIVSISSVSSSL
FT                   GFVGQSIYGGTKAAIEAMTRTWARELSDRATVNAVNPGPVVGDMYFATGEQFWKDIQGY
FT                   QDNTPLSKLDVNNEDTMSRLTDEQKRLIQEKMGGRRPAFTSEIAGVVGMLCTPDGLWCT
FT                   GSVVCANGGMKMGQ"
     MARVLEGKFG IVTGGSRGIG EAIARNLAEK GCSLLLNFTS ESSRAPTEAL CSSLATTHNI        60
     KCESVQADLS KPAEAVTAII TAAKERFSTS GKFQIDILIN NAGVSQDRNL NDANKGPIEA       120
     EHFNWQYSIN VLAPLLLTQA CAPFLPTDRS GRIVSISSVS SSLGFVGQSI YGGTKAAIEA       180
     MTRTWARELS DRATVNAVNP GPVVGDMYFA TGEQFWKDIQ GYQDNTPLSK LDVNNEDTMS       240
     RLTDEQKRLI QEKMGGRRPA FTSEIAGVVG MLCTPDGLWC TGSVVCANGG MKMGQ            295
//

If you have problems or comments...

PBIL Back to PBIL home page