(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE516

PENCW_13.PE516       Location/Qualifiers
FT   CDS             1216549..1217145
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179180" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948810"
FT                   /orf_name="Pc16g05160"
FT                   /product="Pc16g05160 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP93186.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001831B2C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9C3"
FT                   /transl_table=1
FT                   /translation="MPGFSFPPDFTIPTPRLQISPFNPNNPAHCAFLVQLWNTDGFISS
FT                   CGKTGITTPEKAHSFLKGRVSEYYAYHGYGTFLVSRQTEDGVKPIGTVSLTRGIPPGPH
FT                   YLAPDIGFAMLPEECRKGHATEAAKALLEYAGKNLGVEAVFGFCSPANRWSRGALENIG
FT                   MEFRGVKPLKVFGGEDSAVYVLPGMSGDLSVYNLD"
     MPGFSFPPDF TIPTPRLQIS PFNPNNPAHC AFLVQLWNTD GFISSCGKTG ITTPEKAHSF        60
     LKGRVSEYYA YHGYGTFLVS RQTEDGVKPI GTVSLTRGIP PGPHYLAPDI GFAMLPEECR       120
     KGHATEAAKA LLEYAGKNLG VEAVFGFCSP ANRWSRGALE NIGMEFRGVK PLKVFGGEDS       180
     AVYVLPGMSG DLSVYNLD                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page