(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE518

PENCW_13.PE518       Location/Qualifiers
FT   CDS             1218791..1219894
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128966"
FT                   /orf_name="Pc16g05180"
FT                   /product="Pc16g05180 protein"
FT                   /protein_id="CAP93188.1"
FT                   /db_xref="UniParc:UPI0001831B2D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H2"
FT                   /transl_table=1
FT                   /translation="MRYSMINGLLLLTVSPMSVLALPVDPNALPGQWNPSGQHPNNHWQ
FT                   NGQGGWTDANGQWHNNGAVGPRHWPDDHKNQDGWTDGSGKWHPNNPNNQNGQWHANQNG
FT                   QQYNNGWTDANGQWHNDGDVRPRDWPNDHHNNQNGWTDASGKWHANNPNNQNGQWHANN
FT                   QNGWTDASGKWHANNQNGWTDSNGQWHVDHKRDVIPGLNGAVNSNGANLLNGAVRHRRS
FT                   WRDGDNDQNNGNYGEGNNGNGIGNYGNNGNNGNDWNNGNNGNGNWKRGNGNGNGNGNGH
FT                   GNGNNGNNGNNGNNDWKRNDGFNRDIDSVANPSVIPRDSNSDIKSVANPSLVNSVTKPL
FT                   NSRDSNSDIDSVVNPSTIPHDQPTNNA"
     MRYSMINGLL LLTVSPMSVL ALPVDPNALP GQWNPSGQHP NNHWQNGQGG WTDANGQWHN        60
     NGAVGPRHWP DDHKNQDGWT DGSGKWHPNN PNNQNGQWHA NQNGQQYNNG WTDANGQWHN       120
     DGDVRPRDWP NDHHNNQNGW TDASGKWHAN NPNNQNGQWH ANNQNGWTDA SGKWHANNQN       180
     GWTDSNGQWH VDHKRDVIPG LNGAVNSNGA NLLNGAVRHR RSWRDGDNDQ NNGNYGEGNN       240
     GNGIGNYGNN GNNGNDWNNG NNGNGNWKRG NGNGNGNGNG HGNGNNGNNG NNGNNDWKRN       300
     DGFNRDIDSV ANPSVIPRDS NSDIKSVANP SLVNSVTKPL NSRDSNSDID SVVNPSTIPH       360
     DQPTNNA                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page