(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE519

PENCW_13.PE519       Location/Qualifiers
FT   CDS             join(1221277..1221658,1221718..1221910,1221960..1222059)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128967"
FT                   /orf_name="Pc16g05190"
FT                   /product="Putative uncharacterized protein Pc16g05190 "
FT                   /protein_id="CAP93189.1"
FT                   /db_xref="UniParc:UPI0001831B2E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H3"
FT                   /transl_table=1
FT                   /translation="MHANVDSGKLLIGSLCGAEDPYVQYSAYFWGIIGICSHFKASTDL
FT                   FWKIPRYSTTMGGLNYGWPNLEIHSTFKAYKYTKTSLIRLVLQPIHLLQTFKNLIKLAN
FT                   MKVFTPIFVLIAFATSQAIAVPAAEAVDLETRADYCVDIKVCHGYNYEGGCYKECKRPG
FT                   KAYDIKKEYQKNAGSFKIGTKGYKCHIGSPDHGTLPVDYPGTKRLRNDFINNITGYQCN
FT                   KV"
     MHANVDSGKL LIGSLCGAED PYVQYSAYFW GIIGICSHFK ASTDLFWKIP RYSTTMGGLN        60
     YGWPNLEIHS TFKAYKYTKT SLIRLVLQPI HLLQTFKNLI KLANMKVFTP IFVLIAFATS       120
     QAIAVPAAEA VDLETRADYC VDIKVCHGYN YEGGCYKECK RPGKAYDIKK EYQKNAGSFK       180
     IGTKGYKCHI GSPDHGTLPV DYPGTKRLRN DFINNITGYQ CNKV                        224
//

If you have problems or comments...

PBIL Back to PBIL home page