(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE520

PENCW_13.PE520       Location/Qualifiers
FT   CDS             join(complement(1223525..1223815),
FT                   complement(1223153..1223460),complement(1222269..1223079))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000201861" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977839"
FT                   /orf_name="Pc16g05200"
FT                   /product="Pc16g05200 protein"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP93190.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001831BFF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H4"
FT                   /transl_table=1
FT                   /translation="MLFSFGTALCALGTASALVISERGVETRDVSGTAHVYLKESNGPS
FT                   QHYASGYIYGIPDTPNQIPDHFYSDIAFQYTRAGGAQTPESKGWIGGQDDYTFRWESTL
FT                   SNYRTARQQGGQFILLVHDLWGADSLQSEDAPFPGDNDDWSFYDEFLSALISDIKDNDL
FT                   IDGVTIDIWNEPDGRNFWDREQDQYLLMWGRATARFKSELPNLALSGPSVSYPPTPDDE
FT                   WWNNWASYVVSNQSLPEEHHWHSLSKTFTSTEMLKNYDALLAKYSATREGLVNINEYGH
FT                   PDEQNPSGSAWWIAQLERANIFGCRANWASAYALHDFMAQLLGKPGAGTDDYDPKATGY
FT                   YPNGEYQVYKYYASSMVGDRIKTETTMDTNGDVYATVDAEGGVLRLLAGARTTTGTWSI
FT                   QLEELSALGLPKSGEVGIHTYEFPGSDDPYARLDEPVDLGTVTHKYSEDSLTFPIYSEN
FT                   VYDAWAFEIKF"
     MLFSFGTALC ALGTASALVI SERGVETRDV SGTAHVYLKE SNGPSQHYAS GYIYGIPDTP        60
     NQIPDHFYSD IAFQYTRAGG AQTPESKGWI GGQDDYTFRW ESTLSNYRTA RQQGGQFILL       120
     VHDLWGADSL QSEDAPFPGD NDDWSFYDEF LSALISDIKD NDLIDGVTID IWNEPDGRNF       180
     WDREQDQYLL MWGRATARFK SELPNLALSG PSVSYPPTPD DEWWNNWASY VVSNQSLPEE       240
     HHWHSLSKTF TSTEMLKNYD ALLAKYSATR EGLVNINEYG HPDEQNPSGS AWWIAQLERA       300
     NIFGCRANWA SAYALHDFMA QLLGKPGAGT DDYDPKATGY YPNGEYQVYK YYASSMVGDR       360
     IKTETTMDTN GDVYATVDAE GGVLRLLAGA RTTTGTWSIQ LEELSALGLP KSGEVGIHTY       420
     EFPGSDDPYA RLDEPVDLGT VTHKYSEDSL TFPIYSENVY DAWAFEIKF                   469
//

If you have problems or comments...

PBIL Back to PBIL home page