(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE525

PENCW_13.PE525       Location/Qualifiers
FT   CDS             join(complement(1236273..1236728),
FT                   complement(1236087..1236139),complement(1235560..1235947))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977840"
FT                   /orf_name="Pc16g05250"
FT                   /product="Pc16g05250 protein"
FT                   /protein_id="CAP93195.1"
FT                   /db_xref="UniParc:UPI0001831C03"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H8"
FT                   /transl_table=1
FT                   /translation="MLQSALYRILRIFLVTLDFWFNTDIPTSQVDRSGKPSQSIPVNNM
FT                   DPSSSAQQTETSTSDLIELQTWEEIYIEECLSFKASLETQARILRNTSEGVNRIKDVRK
FT                   ELISLSHQAERIKEAAFEMVDETPDSVYVRNATPEWLSSRLGDPQLEQCECINFPATSY
FT                   RTFKCTKLGMLYYPNILARYSQSDLTPYVWLGIEVVKRFNLALYRVYQACSRIGKEDSN
FT                   THEQDITATPNSGFNVKDLQFPLPRMWRSRSKGEWEATSTVGVFCRLLDDTMDEELISK
FT                   AEKDLGADWEQNDALHG"
     MLQSALYRIL RIFLVTLDFW FNTDIPTSQV DRSGKPSQSI PVNNMDPSSS AQQTETSTSD        60
     LIELQTWEEI YIEECLSFKA SLETQARILR NTSEGVNRIK DVRKELISLS HQAERIKEAA       120
     FEMVDETPDS VYVRNATPEW LSSRLGDPQL EQCECINFPA TSYRTFKCTK LGMLYYPNIL       180
     ARYSQSDLTP YVWLGIEVVK RFNLALYRVY QACSRIGKED SNTHEQDITA TPNSGFNVKD       240
     LQFPLPRMWR SRSKGEWEAT STVGVFCRLL DDTMDEELIS KAEKDLGADW EQNDALHG         298
//

If you have problems or comments...

PBIL Back to PBIL home page