(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE526

PENCW_13.PE526       Location/Qualifiers
FT   CDS             join(1237674..1238531,1238593..1239183)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000212705" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128968"
FT                   /orf_name="Pc16g05260"
FT                   /product="Pc16g05260 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93196.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831C04"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9H9"
FT                   /transl_table=1
FT                   /translation="MGLIPLQFKNPPKYMLACILCSANGILFGMDTGIIGPVTDMKDFK
FT                   KSFGSQNSTIHGLIVSCILIPAALSSFFAGYVADRLGRPKGICIGVFIFGAGAAIEAGA
FT                   VALSMFIVGRIVEGVGEGLFLGNLVVLICEISPTSTRGALTTGPQLATTLGLVMGYFIS
FT                   YGTSSLRSSLSWRMPFILLAAFSMVLCGLSLLYLPESPQWLGLHGRYAMAEEAWDRLGV
FT                   SRAEREKVVLQVRTQEVNSETEKVKDGTIDKLLAIFSKDVIGRTILAVFLMGMQQMSGI
FT                   DGVLYYAPQLFQKAGLASSEASFLASGVSALVIFAVTIPGLIYADKWGRRSSIVYGGVV
FT                   MGILMFLMGGLYAGNAVHKTTGAGRWVVIVCIYIFSAIYSVSWGISVKVYSAEIQPQRT
FT                   RASATTLAHSSNWVCNFLVALTTPVLLAKSSFGAYFLFGGCCVITVVVGIVFMHETKGR
FT                   TFGEIEEAFKGKSRGGKNKFGRGV"
     MGLIPLQFKN PPKYMLACIL CSANGILFGM DTGIIGPVTD MKDFKKSFGS QNSTIHGLIV        60
     SCILIPAALS SFFAGYVADR LGRPKGICIG VFIFGAGAAI EAGAVALSMF IVGRIVEGVG       120
     EGLFLGNLVV LICEISPTST RGALTTGPQL ATTLGLVMGY FISYGTSSLR SSLSWRMPFI       180
     LLAAFSMVLC GLSLLYLPES PQWLGLHGRY AMAEEAWDRL GVSRAEREKV VLQVRTQEVN       240
     SETEKVKDGT IDKLLAIFSK DVIGRTILAV FLMGMQQMSG IDGVLYYAPQ LFQKAGLASS       300
     EASFLASGVS ALVIFAVTIP GLIYADKWGR RSSIVYGGVV MGILMFLMGG LYAGNAVHKT       360
     TGAGRWVVIV CIYIFSAIYS VSWGISVKVY SAEIQPQRTR ASATTLAHSS NWVCNFLVAL       420
     TTPVLLAKSS FGAYFLFGGC CVITVVVGIV FMHETKGRTF GEIEEAFKGK SRGGKNKFGR       480
     GV                                                                      482
//

If you have problems or comments...

PBIL Back to PBIL home page