(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE527

PENCW_13.PE527       Location/Qualifiers
FT   CDS             join(1240612..1240648,1240775..1241349,1241404..1241433)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948814"
FT                   /orf_name="Pc16g05270"
FT                   /product="Pc16g05270 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93197.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831C05"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I0"
FT                   /transl_table=1
FT                   /translation="MSAAFVGEALPGACQTCRRRKTKCDSNYPCSTCVDGGESCVREPS
FT                   SRQAFTPVTRSSREGSHRKQKTPINAEELDPTSAWNLTMPSAEDTSPIQVSHMRLDWNP
FT                   PMNRSASNSIANTRSALRDVCAEDPLQPLIDPLVAVMSGINTTTSTPSENPLYYGRPSD
FT                   IMSFPFEAPFWQPSELRDYVGTDQSEVYMSNVPTYNPADFQQTQLPQYLG"
     MSAAFVGEAL PGACQTCRRR KTKCDSNYPC STCVDGGESC VREPSSRQAF TPVTRSSREG        60
     SHRKQKTPIN AEELDPTSAW NLTMPSAEDT SPIQVSHMRL DWNPPMNRSA SNSIANTRSA       120
     LRDVCAEDPL QPLIDPLVAV MSGINTTTST PSENPLYYGR PSDIMSFPFE APFWQPSELR       180
     DYVGTDQSEV YMSNVPTYNP ADFQQTQLPQ YLG                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page