(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE528

PENCW_13.PE528       Location/Qualifiers
FT   CDS             join(1242415..1242578,1242640..1243657)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948815"
FT                   /orf_name="Pc16g05280"
FT                   /product="Putative uncharacterized protein Pc16g05280 "
FT                   /protein_id="CAP93198.1"
FT                   /db_xref="UniParc:UPI0001831C06"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I1"
FT                   /transl_table=1
FT                   /translation="MRMRTLWWTSSLAYFVSFVNVGYGYSCVSQWCDTCLPAEVHDAPG
FT                   VGFDLTPSYGTAVVHYHNGTVVEVAKIPGSPEYLELMARLATTSKPSPNSTLDSISEIS
FT                   SQLMENLLPDVSSPWRDWWRWLNTKLGRPVKPDEVEIISDLLQQLKVSTERRISQPLDR
FT                   VAVTDPGFQSLESATLNAALRMLDLRTWVGDSIYYAHRIVEGDAVYAANGYGLCTDYLD
FT                   PSLCSDEFAESPDSTVLFVSYNRNLLYTSIVEGVTSEAFSRITRVEAQLVDYELGLDRL
FT                   LEKDEAALWDRLRSQLQILPREFEHPITHLLLAGESVTHPRFLATLRDSISELSPDVVN
FT                   IKLAIDPTFAAARGAALYARRRQEVQSNCTERSECEETRLHERLHTPTQVELH"
     MRMRTLWWTS SLAYFVSFVN VGYGYSCVSQ WCDTCLPAEV HDAPGVGFDL TPSYGTAVVH        60
     YHNGTVVEVA KIPGSPEYLE LMARLATTSK PSPNSTLDSI SEISSQLMEN LLPDVSSPWR       120
     DWWRWLNTKL GRPVKPDEVE IISDLLQQLK VSTERRISQP LDRVAVTDPG FQSLESATLN       180
     AALRMLDLRT WVGDSIYYAH RIVEGDAVYA ANGYGLCTDY LDPSLCSDEF AESPDSTVLF       240
     VSYNRNLLYT SIVEGVTSEA FSRITRVEAQ LVDYELGLDR LLEKDEAALW DRLRSQLQIL       300
     PREFEHPITH LLLAGESVTH PRFLATLRDS ISELSPDVVN IKLAIDPTFA AARGAALYAR       360
     RRQEVQSNCT ERSECEETRL HERLHTPTQV ELH                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page