(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE529

PENCW_13.PE529       Location/Qualifiers
FT   CDS             join(complement(1246271..1246444),
FT                   complement(1245818..1246237))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076681" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948816"
FT                   /orf_name="Pc16g05290"
FT                   /product="Putative uncharacterized protein Pc16g05290 "
FT                   /protein_id="CAP93199.1"
FT                   /db_xref="UniParc:UPI0001831C07"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I2"
FT                   /transl_table=1
FT                   /translation="MSDMEVQVAAQTRAALKADLTLRCVLRGKYRHKSRRSADVIPWAQ
FT                   SRVERLSNAVLRELNVIQMLRLRNVVYIFYDLFLDECDKQVRTEITESFHTKRPIHAIT
FT                   RKGKVYIMRRDERADKDVAQQYAQMSSIDKGPRPFFSDLADPPFYNEHGRRIERGEEGY
FT                   VPLAEMLREDDRRLQEEADEKRRQDEPDGNMEQD"
     MSDMEVQVAA QTRAALKADL TLRCVLRGKY RHKSRRSADV IPWAQSRVER LSNAVLRELN        60
     VIQMLRLRNV VYIFYDLFLD ECDKQVRTEI TESFHTKRPI HAITRKGKVY IMRRDERADK       120
     DVAQQYAQMS SIDKGPRPFF SDLADPPFYN EHGRRIERGE EGYVPLAEML REDDRRLQEE       180
     ADEKRRQDEP DGNMEQD                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page