(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE53

PENCW_13.PE53        Location/Qualifiers
FT   CDS             join(114680..115923,116071..116271,116359..116401)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213030" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945527"
FT                   /orf_name="Pc16g00530"
FT                   /product="Pc16g00530 protein"
FT                   /function="DNA binding"
FT                   /biological_process="DNA integration"
FT                   /protein_id="CAP92723.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0015074"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI000183115D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W3"
FT                   /transl_table=1
FT                   /translation="MPSRQLRTGVDWVLDSGSSWHICSNRDLFISYKAYRSDEGLGWDS
FT                   SASQRAKAEGAGDIILPIRRPDGSRYELQVQCLYKPGNRFNLLSLLAIRQQKGIRWNPD
FT                   DMIIRDENRAEIGYTFVGMNVPFIELADEPNPVIYKNQMTNQALTHQTSVQNQQFGPQQ
FT                   QANGAISYALISAELAHRRLGHIGSYKGRINKDKLGEDVDTKECFDCEPCHKAKSKKIV
FT                   SREKQARATKVGQLVYVDLHPYKPKGLSKMGKQDREHAMIITDDASRFRTTMCIAKKGE
FT                   ASPTLILWAETFKNHTGYYLMEWRFDNGTEFLHFQKWAKEKNLTVSPSSAYAHEQNGVA
FT                   EFSGHYVMQIARTMHIDGGALRELWTEACYAATYVINRLIRHGEEAPILAWRRAMNLRG
FT                   DEATNLSFLRVWYSKADVVFWEPKAPKTYDGAADFRIGETTDVMTPKTQFKLGKALFKT
FT                   ARQAAKDLGSTDIGQHVSLGEEHRVQALRDRRETPDR"
     MPSRQLRTGV DWVLDSGSSW HICSNRDLFI SYKAYRSDEG LGWDSSASQR AKAEGAGDII        60
     LPIRRPDGSR YELQVQCLYK PGNRFNLLSL LAIRQQKGIR WNPDDMIIRD ENRAEIGYTF       120
     VGMNVPFIEL ADEPNPVIYK NQMTNQALTH QTSVQNQQFG PQQQANGAIS YALISAELAH       180
     RRLGHIGSYK GRINKDKLGE DVDTKECFDC EPCHKAKSKK IVSREKQARA TKVGQLVYVD       240
     LHPYKPKGLS KMGKQDREHA MIITDDASRF RTTMCIAKKG EASPTLILWA ETFKNHTGYY       300
     LMEWRFDNGT EFLHFQKWAK EKNLTVSPSS AYAHEQNGVA EFSGHYVMQI ARTMHIDGGA       360
     LRELWTEACY AATYVINRLI RHGEEAPILA WRRAMNLRGD EATNLSFLRV WYSKADVVFW       420
     EPKAPKTYDG AADFRIGETT DVMTPKTQFK LGKALFKTAR QAAKDLGSTD IGQHVSLGEE       480
     HRVQALRDRR ETPDR                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page