(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE530

PENCW_13.PE530       Location/Qualifiers
FT   CDS             join(complement(1247206..1247405),
FT                   complement(1247014..1247149))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824620"
FT                   /orf_name="Pc16g05300"
FT                   /product="Putative uncharacterized protein Pc16g05300 "
FT                   /protein_id="CAP93200.1"
FT                   /db_xref="UniParc:UPI0001831C08"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I3"
FT                   /transl_table=1
FT                   /translation="MSHVHAAPVGGSPPPTEDIPHPGSVESLVAALGASGVRSLLWDVF
FT                   FFFCAVVAILRLDHFFKRVIDRGFPPPTPPPELPVRRRPPMTAEDHDRILAEYRVNRPP
FT                   ATPQGDE"
     MSHVHAAPVG GSPPPTEDIP HPGSVESLVA ALGASGVRSL LWDVFFFFCA VVAILRLDHF        60
     FKRVIDRGFP PPTPPPELPV RRRPPMTAED HDRILAEYRV NRPPATPQGD E                111
//

If you have problems or comments...

PBIL Back to PBIL home page