(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE531

PENCW_13.PE531       Location/Qualifiers
FT   CDS             complement(1247864..1248694)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076657" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977841"
FT                   /orf_name="Pc16g05310"
FT                   /product="Pc16g05310 protein"
FT                   /protein_id="CAP93201.1"
FT                   /db_xref="UniParc:UPI0001831C09"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I4"
FT                   /transl_table=1
FT                   /translation="MRPADELNQPKFVLTLPREKTQDEIEIERSGDIDALQRYRWNVVH
FT                   QNKYHYANRAVELLRVEQELRSTVQEEQILAEKPETTRIWSIYNDTQAKLQALDKRYWL
FT                   LERQWWKVRNSFVEGPLIRAFDLWRSHPLWYMHRALVEDCERRGGCCSRSCGCCVNREI
FT                   GKTRQLGAGHCMVACGCCHRARGFELTEKEKMGFLTDFHIVDDNSVYRQRINRVSIWGL
FT                   SLDSHVSPFDMIIMPRGCKKVLSKEQMTKGKVEQVEEASALIDDEEKKEAASGY"
     MRPADELNQP KFVLTLPREK TQDEIEIERS GDIDALQRYR WNVVHQNKYH YANRAVELLR        60
     VEQELRSTVQ EEQILAEKPE TTRIWSIYND TQAKLQALDK RYWLLERQWW KVRNSFVEGP       120
     LIRAFDLWRS HPLWYMHRAL VEDCERRGGC CSRSCGCCVN REIGKTRQLG AGHCMVACGC       180
     CHRARGFELT EKEKMGFLTD FHIVDDNSVY RQRINRVSIW GLSLDSHVSP FDMIIMPRGC       240
     KKVLSKEQMT KGKVEQVEEA SALIDDEEKK EAASGY                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page