(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE532

PENCW_13.PE532       Location/Qualifiers
FT   CDS             1249463..1250245
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217883" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824621"
FT                   /orf_name="Pc16g05320"
FT                   /product="Pc16g05320 protein"
FT                   /protein_id="CAP93202.1"
FT                   /db_xref="InterPro:IPR021369"
FT                   /db_xref="UniParc:UPI0001831C0A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I5"
FT                   /transl_table=1
FT                   /translation="MGSQDSLLSTIRHQNHTWEDGKQTENNRLLELRRKVQDFVYTPFG
FT                   CLITVYVLNVIAWGGMDFLLICNFVPAMCHPTCEDPHSPRLEWIEIDSQILVALLCVPA
FT                   FALAPLRYRDLYHLLRYRLCRNRGCLRKLAGYNKDWFRVYGDFEAKLDLEDAGVTREIT
FT                   EDYCSGPVAAAPLHLSTSPWKLDFVVWCKALNTAFQATLAGFMWGYKRLDRPPWSSTIS
FT                   MLFAFSCIAMAKITVFLEDRRVRDLEAPETILLWTIQR"
     MGSQDSLLST IRHQNHTWED GKQTENNRLL ELRRKVQDFV YTPFGCLITV YVLNVIAWGG        60
     MDFLLICNFV PAMCHPTCED PHSPRLEWIE IDSQILVALL CVPAFALAPL RYRDLYHLLR       120
     YRLCRNRGCL RKLAGYNKDW FRVYGDFEAK LDLEDAGVTR EITEDYCSGP VAAAPLHLST       180
     SPWKLDFVVW CKALNTAFQA TLAGFMWGYK RLDRPPWSST ISMLFAFSCI AMAKITVFLE       240
     DRRVRDLEAP ETILLWTIQR                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page