(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE533

PENCW_13.PE533       Location/Qualifiers
FT   CDS             join(1250786..1250933,1251016..1251179,1251245..1251348,
FT                   1251409..1251853)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205324" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948817"
FT                   /orf_name="Pc16g05330"
FT                   /product="Pc16g05330 protein"
FT                   /protein_id="CAP93203.1"
FT                   /db_xref="UniParc:UPI0001831C0B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I6"
FT                   /transl_table=1
FT                   /translation="MLTQLQQESMQSGRAIAGILPSPRVDQEKSCRTVPMRVLVLGLSR
FT                   TGTESLIQLGYDGTYHGYTAAVESPRDCKTWLRAMRAKFDGVGAPFVREDWDQLLGHYQ
FT                   AVCDVPAACFADELMTAYPNAKVILTNRDTDEWFYSVSKTLVANAFTRKASLISLFATI
FT                   TRSPNRWTRPTMMYALSDFFDGDFERNGKQTYREHYRRVREMARERKMELLDYEIKDGW
FT                   EPLCKFLGHDVPVGPFPCGNDKQEVNARIKAIINREIQRLLLIFAFLFSCFAFTGLATI
FT                   TLVGI"
     MLTQLQQESM QSGRAIAGIL PSPRVDQEKS CRTVPMRVLV LGLSRTGTES LIQLGYDGTY        60
     HGYTAAVESP RDCKTWLRAM RAKFDGVGAP FVREDWDQLL GHYQAVCDVP AACFADELMT       120
     AYPNAKVILT NRDTDEWFYS VSKTLVANAF TRKASLISLF ATITRSPNRW TRPTMMYALS       180
     DFFDGDFERN GKQTYREHYR RVREMARERK MELLDYEIKD GWEPLCKFLG HDVPVGPFPC       240
     GNDKQEVNAR IKAIINREIQ RLLLIFAFLF SCFAFTGLAT ITLVGI                      286
//

If you have problems or comments...

PBIL Back to PBIL home page