(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE534

PENCW_13.PE534       Location/Qualifiers
FT   CDS             join(1252945..1252985,1253035..1253422,1253484..1254002)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217882" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948818"
FT                   /orf_name="Pc16g05340"
FT                   /product="Pc16g05340 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="carotenoid biosynthetic process "
FT                   /biological_process="chlorophyll biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="photosynthesis"
FT                   /protein_id="CAP93204.1"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0015995"
FT                   /db_xref="GO:0016117"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR010791"
FT                   /db_xref="UniParc:UPI0001831C0C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H9I7"
FT                   /transl_table=1
FT                   /translation="MVWLDEENPNNLNSYFFLFWFTTMDGRKYHVTLAPNFFRGRTTGI
FT                   FRVEDLQDLSSTGATVFAPGTGSNEFLDFRSEIQNLTSPRVSDNYTDLNVSTNYAGVQL
FT                   NVHITPTGKNLYIGGGGGITLSSDDNDFRRIIPGYSWYWGNPTLRLNGTITIDGEEIAV
FT                   DHDQSRGYFERQWGEFGISGGHYGYWLYLSNGLMIHGWVVSPTTEQPFGVPAWATVWHP
FT                   NGVHEVVEVGKNTTAFDVWKSEYSGRNYFNQVELDIPSRQARFDIHQLIRESEVRPLSG
FT                   TDGYNISEAYAQGQGVWEGEPVTFFGHLEQLSFW"
     MVWLDEENPN NLNSYFFLFW FTTMDGRKYH VTLAPNFFRG RTTGIFRVED LQDLSSTGAT        60
     VFAPGTGSNE FLDFRSEIQN LTSPRVSDNY TDLNVSTNYA GVQLNVHITP TGKNLYIGGG       120
     GGITLSSDDN DFRRIIPGYS WYWGNPTLRL NGTITIDGEE IAVDHDQSRG YFERQWGEFG       180
     ISGGHYGYWL YLSNGLMIHG WVVSPTTEQP FGVPAWATVW HPNGVHEVVE VGKNTTAFDV       240
     WKSEYSGRNY FNQVELDIPS RQARFDIHQL IRESEVRPLS GTDGYNISEA YAQGQGVWEG       300
     EPVTFFGHLE QLSFW                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page