(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE538

PENCW_13.PE538       Location/Qualifiers
FT   CDS             join(complement(1259270..1259343),
FT                   complement(1257957..1259220),complement(1256973..1257785))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824622"
FT                   /orf_name="Pc16g05380"
FT                   /product="Pc16g05380 protein"
FT                   /function="ATP binding"
FT                   /function="protein tyrosine kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP93208.1"
FT                   /db_xref="GO:0004713"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831CE0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H878"
FT                   /transl_table=1
FT                   /translation="MACRIPDLVLHGRPSQLPLPQPAAHLQSVAGSTRVFGEFHQGSGS
FT                   VLADDDDDILRFCERAQQVFKAQSARCFVHGFLVRGTTLELWAFDRSGAYSGKRLDLTQ
FT                   RPDLLVRTLAGYALMSDEEVGFNTFVKNAPGSDSYVAFDHRDKLHLRPELIATADYTVG
FT                   PGTTCYVASTSTVGEPDTVIKFSWREDEEPTEVRLLKRAHERNACGVIQVLGYQDLVNI
FT                   ADLRQGLHFPQTFANRTFSCVATTPLGRPIRQFTSIPELLEVLRDLVKALQSLCVNARI
FT                   LHRDVAIKNLIITPQHSANSPRGVLLDFDFALDLDNVRPIEPMVGSDGFMAIGILSGQR
FT                   HTYRHDLESLFYVFLWIAIANDRAHDEANDILEGLPKTSRLWKWCTMDFGAVGRDKAAD
FT                   MSPEGFEEILDEFSSDFAPLRGLAKELHALLFPMCDGKIFTGTETDQNIAHNDNWYPCF
FT                   TGLLSSGGLSQMTWKPGEQNVAETYAGDLKHLRDLLDMHDMPASVCIKLIHIHIHLNKG
FT                   EILVVHELDAPPHGKTPFLEPMAPDVAGKVYGCNYIVDDSGDLQGFEYTTIEGGPDLAA
FT                   YPSFVAEFRAAVVQRGVQHNFALAVNLGAAQRGSWMELDFPEKRATFLLPSHVPLPQSD
FT                   RLVLRTTITKFPSPKNEKNGTKDLPTHGHIEHTWGSSKRIGVDDEEPVDGVTTKNGLHL
FT                   MGVPLEPGTAFYMAVSAISAAV"
     MACRIPDLVL HGRPSQLPLP QPAAHLQSVA GSTRVFGEFH QGSGSVLADD DDDILRFCER        60
     AQQVFKAQSA RCFVHGFLVR GTTLELWAFD RSGAYSGKRL DLTQRPDLLV RTLAGYALMS       120
     DEEVGFNTFV KNAPGSDSYV AFDHRDKLHL RPELIATADY TVGPGTTCYV ASTSTVGEPD       180
     TVIKFSWRED EEPTEVRLLK RAHERNACGV IQVLGYQDLV NIADLRQGLH FPQTFANRTF       240
     SCVATTPLGR PIRQFTSIPE LLEVLRDLVK ALQSLCVNAR ILHRDVAIKN LIITPQHSAN       300
     SPRGVLLDFD FALDLDNVRP IEPMVGSDGF MAIGILSGQR HTYRHDLESL FYVFLWIAIA       360
     NDRAHDEAND ILEGLPKTSR LWKWCTMDFG AVGRDKAADM SPEGFEEILD EFSSDFAPLR       420
     GLAKELHALL FPMCDGKIFT GTETDQNIAH NDNWYPCFTG LLSSGGLSQM TWKPGEQNVA       480
     ETYAGDLKHL RDLLDMHDMP ASVCIKLIHI HIHLNKGEIL VVHELDAPPH GKTPFLEPMA       540
     PDVAGKVYGC NYIVDDSGDL QGFEYTTIEG GPDLAAYPSF VAEFRAAVVQ RGVQHNFALA       600
     VNLGAAQRGS WMELDFPEKR ATFLLPSHVP LPQSDRLVLR TTITKFPSPK NEKNGTKDLP       660
     THGHIEHTWG SSKRIGVDDE EPVDGVTTKN GLHLMGVPLE PGTAFYMAVS AISAAV           716
//

If you have problems or comments...

PBIL Back to PBIL home page