(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE54

PENCW_13.PE54        Location/Qualifiers
FT   CDS             117077..118711
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076649" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823846"
FT                   /orf_name="Pc16g00540"
FT                   /product="Pc16g00540 protein"
FT                   /protein_id="CAP92724.1"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="UniParc:UPI000183115E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6V9"
FT                   /transl_table=1
FT                   /translation="MKSEFKDKWHEAMKVQLGKLQDAKAYEIAPRPPSGCTVLPGKWVF
FT                   DLKINKDNEVQEFRARWVICGNRQRPGFDFQESYAPVARGETMRLFLSMVAVNKMIIEQ
FT                   VDYTAAYLNAMIDDRVIYMRQLTGFETRGLDGEKKDEICLVLQALYGLRQAGHLWYETL
FT                   ANALRDMDFQPLLDEPCIWIHREKQIWILLYVDDTLIAAFKAAEIDWFKTMIPFRYKDL
FT                   GKPARFLGSSLSRNNENGAIFLNQAAYTEEVVVKSGLQDASHVYLPMKTGYKCPDITRD
FT                   PKDKDVRGQNNKDIQREQNDDDDVASWAYDKPSVSKEEASAFMEDIGELGWLADKSRPD
FT                   IAVAVNKLQRRTSAPRQEDIDALKQLIRYLKGTKNLGILLGRNGDNNDLVGYVDASYQD
FT                   CEDGKSTEAYIFFHAGSPISWNSRKEEIVARSSTSAEYVAMDGAVREAMWLYKVMKQMG
FT                   IHQDLPITIFTDSDNAHTIMKKDNFAKATKWLDARYHFVRHAVRTGIISFTLIPSAENV
FT                   ADALTKPLGREQFERMREIMMYSEGKK"
     MKSEFKDKWH EAMKVQLGKL QDAKAYEIAP RPPSGCTVLP GKWVFDLKIN KDNEVQEFRA        60
     RWVICGNRQR PGFDFQESYA PVARGETMRL FLSMVAVNKM IIEQVDYTAA YLNAMIDDRV       120
     IYMRQLTGFE TRGLDGEKKD EICLVLQALY GLRQAGHLWY ETLANALRDM DFQPLLDEPC       180
     IWIHREKQIW ILLYVDDTLI AAFKAAEIDW FKTMIPFRYK DLGKPARFLG SSLSRNNENG       240
     AIFLNQAAYT EEVVVKSGLQ DASHVYLPMK TGYKCPDITR DPKDKDVRGQ NNKDIQREQN       300
     DDDDVASWAY DKPSVSKEEA SAFMEDIGEL GWLADKSRPD IAVAVNKLQR RTSAPRQEDI       360
     DALKQLIRYL KGTKNLGILL GRNGDNNDLV GYVDASYQDC EDGKSTEAYI FFHAGSPISW       420
     NSRKEEIVAR SSTSAEYVAM DGAVREAMWL YKVMKQMGIH QDLPITIFTD SDNAHTIMKK       480
     DNFAKATKWL DARYHFVRHA VRTGIISFTL IPSAENVADA LTKPLGREQF ERMREIMMYS       540
     EGKK                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page