(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE540

PENCW_13.PE540       Location/Qualifiers
FT   CDS             join(1261525..1261619,1261833..1262706)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977842"
FT                   /orf_name="Pc16g05400"
FT                   /product="Pc16g05400 protein"
FT                   /protein_id="CAP93210.1"
FT                   /db_xref="UniParc:UPI0001831CE1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H879"
FT                   /transl_table=1
FT                   /translation="MQVSALTRSEVATLPIISYSTCQEIIEISQQSQIVPVFGRSPFTA
FT                   MMASSLLPLLLYFTYLPSVSAWIFSWHEPDGKLLTVQNDVSQDCKLMNNPEGNVFDWTP
FT                   QEGYWCIFLYGNTHCEEPSEGYTCKTYPWPDHVSSADLLSFKVKNNTSAFESSTSSISA
FT                   SPSPTNSDSSTSASPSSTDTTSSPTPTITTTPTADATDAASSFSATSASSDKPTISSGA
FT                   IAGIVVGVLAAVAIAGLIFFLIRRRRQNAAQSSVVAGRNATVAMAELPSPHEEKSHALN
FT                   KPIYRAQGFRELHGSDVASEIGSGIERHELDASPIYADKKY"
     MQVSALTRSE VATLPIISYS TCQEIIEISQ QSQIVPVFGR SPFTAMMASS LLPLLLYFTY        60
     LPSVSAWIFS WHEPDGKLLT VQNDVSQDCK LMNNPEGNVF DWTPQEGYWC IFLYGNTHCE       120
     EPSEGYTCKT YPWPDHVSSA DLLSFKVKNN TSAFESSTSS ISASPSPTNS DSSTSASPSS       180
     TDTTSSPTPT ITTTPTADAT DAASSFSATS ASSDKPTISS GAIAGIVVGV LAAVAIAGLI       240
     FFLIRRRRQN AAQSSVVAGR NATVAMAELP SPHEEKSHAL NKPIYRAQGF RELHGSDVAS       300
     EIGSGIERHE LDASPIYADK KY                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page