(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE541

PENCW_13.PE541       Location/Qualifiers
FT   CDS             1263304..1263933
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948820"
FT                   /orf_name="Pc16g05410"
FT                   /product="Pc16g05410 protein"
FT                   /protein_id="CAP93211.1"
FT                   /db_xref="UniParc:UPI0001831CE2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H880"
FT                   /transl_table=1
FT                   /translation="MSAIPCVRSARSSSLLRLGGLQSHHINRPSIQRLHPVSRSLHSMS
FT                   SSNKVRTSPISCQKPLSLRVSILKPTARTYAGQKGSTGKAEADLLVEELQELYEVAKDE
FT                   FEIATESTDSSTIYAASDRESARDALNQLSTVYGLYTARPGEVENETDELSSQVEDSGE
FT                   SDIVETQYNPAEIPQGVKDEVRRRVGHRIRELKNAVEALEERATED"
     MSAIPCVRSA RSSSLLRLGG LQSHHINRPS IQRLHPVSRS LHSMSSSNKV RTSPISCQKP        60
     LSLRVSILKP TARTYAGQKG STGKAEADLL VEELQELYEV AKDEFEIATE STDSSTIYAA       120
     SDRESARDAL NQLSTVYGLY TARPGEVENE TDELSSQVED SGESDIVETQ YNPAEIPQGV       180
     KDEVRRRVGH RIRELKNAVE ALEERATED                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page