(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE542

PENCW_13.PE542       Location/Qualifiers
FT   CDS             join(complement(1266238..1266507),
FT                   complement(1265157..1266150),complement(1264943..1265083),
FT                   complement(1264811..1264887),complement(1264728..1264755),
FT                   complement(1264615..1264677),complement(1264455..1264561))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208039" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977843"
FT                   /orf_name="Pc16g05420"
FT                   /product="Pc16g05420 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP93212.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831CE3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H881"
FT                   /transl_table=1
FT                   /translation="MVSQTQQGDFCLECNWEAFHIDGKTAVDPSGNALQHHLNCSSHET
FT                   QSALPHCEVDEACCDVDDCAIDCGSICGDFTGCDTPTVCSITHCEDNHCESIDPLCFEN
FT                   HCCEGTASQDCGFDALFGLNTPLSLDTGVFPSMAMGNHSVGQATKAIQHQVPGLVDPFQ
FT                   QENFLSSYQTHATHCEQDVSNHFECHDFQKDWQSMFAPPVPTQAEVNPAEVFHMLGMCS
FT                   DFSVCQDQHVPAPQNDLNTFEKPKIDTSNTFNCFHPEHHHVHSHFKNPNDFNLQATRKG
FT                   PHRNHHRCRAHTHAHTHPYSPYSRQSRSSISSHLLSSPGETPPPLEGDTSSVLTTPDFS
FT                   PDDSKLHICKWATEIHGIKAACGATFADCGSLQEHLVATHMNTVNGAKGNGYYCCWEGC
FT                   HRPDEPFSQKSKLQGHFLTHSNYKNFSCSVCGKAFARQATLDRHERSHRGDKPYTCKHC
FT                   GKSFTDSSELKTHSRTHTGEKPFKCTWPGCNFTTGDSSNMSSHRLTHGERRHKCHFPGC
FT                   TKSFTRPDQLKRHQRTTHKQEFSPSLPSPSSDHFTMTPFTLV"
     MVSQTQQGDF CLECNWEAFH IDGKTAVDPS GNALQHHLNC SSHETQSALP HCEVDEACCD        60
     VDDCAIDCGS ICGDFTGCDT PTVCSITHCE DNHCESIDPL CFENHCCEGT ASQDCGFDAL       120
     FGLNTPLSLD TGVFPSMAMG NHSVGQATKA IQHQVPGLVD PFQQENFLSS YQTHATHCEQ       180
     DVSNHFECHD FQKDWQSMFA PPVPTQAEVN PAEVFHMLGM CSDFSVCQDQ HVPAPQNDLN       240
     TFEKPKIDTS NTFNCFHPEH HHVHSHFKNP NDFNLQATRK GPHRNHHRCR AHTHAHTHPY       300
     SPYSRQSRSS ISSHLLSSPG ETPPPLEGDT SSVLTTPDFS PDDSKLHICK WATEIHGIKA       360
     ACGATFADCG SLQEHLVATH MNTVNGAKGN GYYCCWEGCH RPDEPFSQKS KLQGHFLTHS       420
     NYKNFSCSVC GKAFARQATL DRHERSHRGD KPYTCKHCGK SFTDSSELKT HSRTHTGEKP       480
     FKCTWPGCNF TTGDSSNMSS HRLTHGERRH KCHFPGCTKS FTRPDQLKRH QRTTHKQEFS       540
     PSLPSPSSDH FTMTPFTLV                                                    559
//

If you have problems or comments...

PBIL Back to PBIL home page