(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE543

PENCW_13.PE543       Location/Qualifiers
FT   CDS             join(1267752..1267973,1268039..1268197)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208050" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948821"
FT                   /orf_name="Pc16g05430"
FT                   /product="Putative uncharacterized protein Pc16g05430 "
FT                   /protein_id="CAP93213.1"
FT                   /db_xref="UniParc:UPI0001831CE4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H882"
FT                   /transl_table=1
FT                   /translation="MGNICSRSSNQGDPFNQPGRVVGTSSGGTAAPRAPLPAKTNWKAT
FT                   PGRTLGESTADGSTGGTDEARANAAIAAQKRAESASANKGKLGSKLAAQKAQTQAQTLD
FT                   QVSRTERAARDVDGVEAARRWE"
     MGNICSRSSN QGDPFNQPGR VVGTSSGGTA APRAPLPAKT NWKATPGRTL GESTADGSTG        60
     GTDEARANAA IAAQKRAESA SANKGKLGSK LAAQKAQTQA QTLDQVSRTE RAARDVDGVE       120
     AARRWE                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page