(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE544

PENCW_13.PE544       Location/Qualifiers
FT   CDS             join(complement(1272095..1272238),
FT                   complement(1271719..1272027),complement(1268901..1271661),
FT                   complement(1268562..1268836))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000007229" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948822"
FT                   /orf_name="Pc16g05440"
FT                   /product="Pc16g05440 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP93214.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001831CE5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H883"
FT                   /transl_table=1
FT                   /translation="MARHGDTRSPSPVGSTYSSSRRPRREDDRYDRTRRDDGRSYRRSR
FT                   SPERRYRGRERPRDRDAYRRRDLPIDRRDEDTYRPARRDRSRERRRDDDHDFRRRSRDR
FT                   DYRSRRDDSRDRDRRRIDDSADLKLKSRRDDSRDRAASRRSRSRTREPSKPSTPVPTAQ
FT                   TDEEKKAERLAKLEAWKQKQAAEREKKQKEQASVDPKNILEAIDRKSSVSPAPAAFPGK
FT                   SKFDPKAIVKSSTSTAAAPAVLGTDVAVPTSAKAASVTKPTLASAPPATLSGPLKAKGN
FT                   VSGFGLGAKQVPETEKPSASKPLGFGDGDEGSTRKKLEKLPTTPLDVSAPVEDTGDDDD
FT                   VDMQVEGTEEHAAAEARAATERRDTRLQNHNDDVHMEESTNVQADSTPMEVDDAEEVDP
FT                   LDAFMAGLQDSTPPERTTGATFAKKKTNQQPEAMFGDDEDVDVTAVGDEKAEDVLALAA
FT                   IKKKKREMPDIDHTKIEYEPFRKEFYTEPSHLAEMTEEEVASLRLELDGIKVRGHDVPK
FT                   PVQKWSQCGLGVQTLDVVHKLGWESLTSIQAQAIPTIMSGRDVIGVAKTGSGKTGAFLV
FT                   PMFRHIKDQRPLASTDGPISMILAPTRELATQIHKDCKPFLRALGLRAVCAYGGAPIKD
FT                   QIAELKRGAEIIVCTAGRLIDLLAANQGRVLNLRRITYVVLDEGDRMFDMGFGPQVVKI
FT                   MASIRPDRQTVLFSATFPKSMEALARKTLNDPVEITVGGKSVVAREITQIVEVRNNDQK
FT                   FFRLLELLGNLYEDDANEDYRTLIFVDRQEAADDLLKQLMYKGYPCMSIHGGKDQIDRD
FT                   STIQEFKAGVFPILVATSVAARGLDVKQLKLVVNYDAPNHLEDYVHRAGRTGRAGNTGT
FT                   AVTFVTEEQDRYALDIAKALKQSGQEVPEPLQKLVDGFNEKVKAGKEKNFSRHGFGGKG
FT                   LDRLNMERETARLRERKAYKTGDEDEEEDKLETEQESDDRFNKALSAVRSAAAPAVAPA
FT                   APSASMPGVPKGVDLDGKIVVHRTERAPAGASKNPLDKVGSAVADIHARLSRAGVMRSG
FT                   VPIDNRGPDAGAFHATLEINDFPQKARWAVTNRTNVAKILEASGTSITTKGNFYAAGKE
FT                   PGPGELPKLYILVEGETEISVTTAIHELRRLLKDATLAASEGEARAPVGGRYNVL"
     MARHGDTRSP SPVGSTYSSS RRPRREDDRY DRTRRDDGRS YRRSRSPERR YRGRERPRDR        60
     DAYRRRDLPI DRRDEDTYRP ARRDRSRERR RDDDHDFRRR SRDRDYRSRR DDSRDRDRRR       120
     IDDSADLKLK SRRDDSRDRA ASRRSRSRTR EPSKPSTPVP TAQTDEEKKA ERLAKLEAWK       180
     QKQAAEREKK QKEQASVDPK NILEAIDRKS SVSPAPAAFP GKSKFDPKAI VKSSTSTAAA       240
     PAVLGTDVAV PTSAKAASVT KPTLASAPPA TLSGPLKAKG NVSGFGLGAK QVPETEKPSA       300
     SKPLGFGDGD EGSTRKKLEK LPTTPLDVSA PVEDTGDDDD VDMQVEGTEE HAAAEARAAT       360
     ERRDTRLQNH NDDVHMEEST NVQADSTPME VDDAEEVDPL DAFMAGLQDS TPPERTTGAT       420
     FAKKKTNQQP EAMFGDDEDV DVTAVGDEKA EDVLALAAIK KKKREMPDID HTKIEYEPFR       480
     KEFYTEPSHL AEMTEEEVAS LRLELDGIKV RGHDVPKPVQ KWSQCGLGVQ TLDVVHKLGW       540
     ESLTSIQAQA IPTIMSGRDV IGVAKTGSGK TGAFLVPMFR HIKDQRPLAS TDGPISMILA       600
     PTRELATQIH KDCKPFLRAL GLRAVCAYGG APIKDQIAEL KRGAEIIVCT AGRLIDLLAA       660
     NQGRVLNLRR ITYVVLDEGD RMFDMGFGPQ VVKIMASIRP DRQTVLFSAT FPKSMEALAR       720
     KTLNDPVEIT VGGKSVVARE ITQIVEVRNN DQKFFRLLEL LGNLYEDDAN EDYRTLIFVD       780
     RQEAADDLLK QLMYKGYPCM SIHGGKDQID RDSTIQEFKA GVFPILVATS VAARGLDVKQ       840
     LKLVVNYDAP NHLEDYVHRA GRTGRAGNTG TAVTFVTEEQ DRYALDIAKA LKQSGQEVPE       900
     PLQKLVDGFN EKVKAGKEKN FSRHGFGGKG LDRLNMERET ARLRERKAYK TGDEDEEEDK       960
     LETEQESDDR FNKALSAVRS AAAPAVAPAA PSASMPGVPK GVDLDGKIVV HRTERAPAGA      1020
     SKNPLDKVGS AVADIHARLS RAGVMRSGVP IDNRGPDAGA FHATLEINDF PQKARWAVTN      1080
     RTNVAKILEA SGTSITTKGN FYAAGKEPGP GELPKLYILV EGETEISVTT AIHELRRLLK      1140
     DATLAASEGE ARAPVGGRYN VL                                               1162
//

If you have problems or comments...

PBIL Back to PBIL home page