(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE545

PENCW_13.PE545       Location/Qualifiers
FT   CDS             join(1272646..1273149,1273211..1273510,1273572..1273709)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208061" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128969"
FT                   /orf_name="Pc16g05450"
FT                   /product="Pc16g05450 protein"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP93215.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI0001831CE6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H884"
FT                   /transl_table=1
FT                   /translation="MPWLSAARGGFLRTLHRGALSPRTGVSDLQHQLRRVSLTAGSDLA
FT                   RPQVQLLSSTQSMVHSNSFATASTPLKASETPKAKSSKKAGKPKKKPLSETQKEIERIR
FT                   KHRAHIRDLKATALVSGRPKRLPNNAFAIAMSEILPHVKGCSSHKEAFLVAIERAKAIS
FT                   PQDKERLQAQAKANYAANTAAYNSWVQSHTPLQIREANSARLTLSRLENKSYPPLKDDR
FT                   LVTVSRSAYTLYLKERMETEYQGKAGVESFPAIGREWLALPQAEKDRYRKLQIEDRRRY
FT                   ERECQEVYGIPAPESSHYQSPEDYLFQEEPET"
     MPWLSAARGG FLRTLHRGAL SPRTGVSDLQ HQLRRVSLTA GSDLARPQVQ LLSSTQSMVH        60
     SNSFATASTP LKASETPKAK SSKKAGKPKK KPLSETQKEI ERIRKHRAHI RDLKATALVS       120
     GRPKRLPNNA FAIAMSEILP HVKGCSSHKE AFLVAIERAK AISPQDKERL QAQAKANYAA       180
     NTAAYNSWVQ SHTPLQIREA NSARLTLSRL ENKSYPPLKD DRLVTVSRSA YTLYLKERME       240
     TEYQGKAGVE SFPAIGREWL ALPQAEKDRY RKLQIEDRRR YERECQEVYG IPAPESSHYQ       300
     SPEDYLFQEE PET                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page