(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE547

PENCW_13.PE547       Location/Qualifiers
FT   CDS             join(1281434..1281485,1281650..1282215)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948823"
FT                   /orf_name="Pc16g05470"
FT                   /product="Putative uncharacterized protein Pc16g05470 "
FT                   /protein_id="CAP93217.1"
FT                   /db_xref="UniParc:UPI0001831CE7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H885"
FT                   /transl_table=1
FT                   /translation="MNKRSNPMLRSEECSLIHPTSQRHDHIPYMHSITSQLTNPVHQIN
FT                   LQVILREDHKPCQAQTSAPEVHLKTINYTPLTPSTMSVPAAVTDYQKERTNFLSWLEDQ
FT                   ARLIRLQPKSDTISEVKVNLRERSGEYLDRLTEASILMACETSDNIYVTVKPKWFYNDM
FT                   VPKICGLLQIRIPQIAMRLGINPKCDMCVHYIIMNIVAEPGF"
     MNKRSNPMLR SEECSLIHPT SQRHDHIPYM HSITSQLTNP VHQINLQVIL REDHKPCQAQ        60
     TSAPEVHLKT INYTPLTPST MSVPAAVTDY QKERTNFLSW LEDQARLIRL QPKSDTISEV       120
     KVNLRERSGE YLDRLTEASI LMACETSDNI YVTVKPKWFY NDMVPKICGL LQIRIPQIAM       180
     RLGINPKCDM CVHYIIMNIV AEPGF                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page