(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE55

PENCW_13.PE55        Location/Qualifiers
FT   CDS             join(119655..119718,119777..120797,120856..121078,
FT                   121249..121270,121513..121791,121848..121957,1
FT                   22006..122206)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945528"
FT                   /orf_name="Pc16g00550"
FT                   /product="Pc16g00550 protein"
FT                   /protein_id="CAP92725.1"
FT                   /db_xref="UniParc:UPI000183115F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W0"
FT                   /transl_table=1
FT                   /translation="MLGLFRASLIAPLLTVWICCSNAFAANCSSTWIKSVADADKLRQN
FT                   CRIVYGHVGIGPFADNGTVHINLDGVEMIAGTLGESPLMQSDDVTQPYYTLSSSSLEVV
FT                   DAVEIGYYGTKVVNLSLPSLKSARDYFEVGKRAYNLTYLDISSLNFAPSITLSPPNLTT
FT                   LHHTGLRNVTAMSIDAMKIDSLDSLTDNQLNMSQVFIQGPFPNVNEIAIGFISAKHLHI
FT                   NDNSSLTLGGSSTTAMTIKELSLHGITDLKRSAQLQTLKVDTLKLSSSISITDLEIPFD
FT                   DLRSLNIQQRWETHPMKSITLPPKAVDWTGGFDLDIVGAPDLNLTSIYGVNDKGNHVQT
FT                   WYWPKNVSRIRISDVTVGNAFFDPFVAQQKGPWDSQFPPSAVRSFGVSPSVNSSFNCTP
FT                   FVELQSMGRLPDVPFMCDDSKPPTSGVPVHLPIPLSLVILLNVVDSTYLLQQPTSLHHG
FT                   NKNLKAKRATKNDALNKHITRTCKKSVKWKGKTRMLSGSPDYGIWYGEEEDLDLNVVIM
FT                   EAKRPNSASEGVPQALAYMGCVHKQRKDLGKADTTVYGISTDAMNFTFMKLDNKSQWSF
FT                   KLVGVVANGFEQVLGLLVYLMTKAALMSPASSRHASRRAQQGSGGSELSFDHDPENYDQ
FT                   MDIA"
     MLGLFRASLI APLLTVWICC SNAFAANCSS TWIKSVADAD KLRQNCRIVY GHVGIGPFAD        60
     NGTVHINLDG VEMIAGTLGE SPLMQSDDVT QPYYTLSSSS LEVVDAVEIG YYGTKVVNLS       120
     LPSLKSARDY FEVGKRAYNL TYLDISSLNF APSITLSPPN LTTLHHTGLR NVTAMSIDAM       180
     KIDSLDSLTD NQLNMSQVFI QGPFPNVNEI AIGFISAKHL HINDNSSLTL GGSSTTAMTI       240
     KELSLHGITD LKRSAQLQTL KVDTLKLSSS ISITDLEIPF DDLRSLNIQQ RWETHPMKSI       300
     TLPPKAVDWT GGFDLDIVGA PDLNLTSIYG VNDKGNHVQT WYWPKNVSRI RISDVTVGNA       360
     FFDPFVAQQK GPWDSQFPPS AVRSFGVSPS VNSSFNCTPF VELQSMGRLP DVPFMCDDSK       420
     PPTSGVPVHL PIPLSLVILL NVVDSTYLLQ QPTSLHHGNK NLKAKRATKN DALNKHITRT       480
     CKKSVKWKGK TRMLSGSPDY GIWYGEEEDL DLNVVIMEAK RPNSASEGVP QALAYMGCVH       540
     KQRKDLGKAD TTVYGISTDA MNFTFMKLDN KSQWSFKLVG VVANGFEQVL GLLVYLMTKA       600
     ALMSPASSRH ASRRAQQGSG GSELSFDHDP ENYDQMDIA                              639
//

If you have problems or comments...

PBIL Back to PBIL home page