(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE553

PENCW_13.PE553       Location/Qualifiers
FT   CDS             complement(1292318..1292734)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948824"
FT                   /orf_name="Pc16g05530"
FT                   /product="Putative uncharacterized protein Pc16g05530 "
FT                   /protein_id="CAP93223.1"
FT                   /db_xref="UniParc:UPI0001831CEC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H890"
FT                   /transl_table=1
FT                   /translation="MEVAWISLIVSIVSLVVAVANLLLPVKEWLRYCFHRRWPPPERND
FT                   ARRPAGIRLDDVVHTESTCSLAREHTSMTRRIEMLEAAIVLAGVNQTLGPPTPSGSVGD
FT                   RADQHSGELRKSRASKGAGHDGQVDSSSKARSLG"
     MEVAWISLIV SIVSLVVAVA NLLLPVKEWL RYCFHRRWPP PERNDARRPA GIRLDDVVHT        60
     ESTCSLAREH TSMTRRIEML EAAIVLAGVN QTLGPPTPSG SVGDRADQHS GELRKSRASK       120
     GAGHDGQVDS SSKARSLG                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page