(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE554

PENCW_13.PE554       Location/Qualifiers
FT   CDS             join(complement(1293769..1293994),
FT                   complement(1293374..1293699))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824624"
FT                   /orf_name="Pc16g05540"
FT                   /product="Putative uncharacterized protein Pc16g05540 "
FT                   /protein_id="CAP93224.1"
FT                   /db_xref="UniParc:UPI0001831CED"
FT                   /db_xref="UniProtKB/TrEMBL:B6H891"
FT                   /transl_table=1
FT                   /translation="MPKPSRLQDLKIPINTDENWDADDEDCGSDTTLDSFDSVPLSLAL
FT                   GSKDDGKGPFDKSLFHFSVNREETNLLGAPGTDLEWTATFEQWRPQWNKIQVQAKRFGY
FT                   TQFSSEIAPAPVDLALVRFVGFGHDQEHREFEIEQEGQDSIADCQDIWTLWRYIIETPA
FT                   NQIREFHVCLRDTARLVGLQ"
     MPKPSRLQDL KIPINTDENW DADDEDCGSD TTLDSFDSVP LSLALGSKDD GKGPFDKSLF        60
     HFSVNREETN LLGAPGTDLE WTATFEQWRP QWNKIQVQAK RFGYTQFSSE IAPAPVDLAL       120
     VRFVGFGHDQ EHREFEIEQE GQDSIADCQD IWTLWRYIIE TPANQIREFH VCLRDTARLV       180
     GLQ                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page