(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE555

PENCW_13.PE555       Location/Qualifiers
FT   CDS             join(complement(1295701..1295730),
FT                   complement(1295421..1295610),complement(1295307..1295349),
FT                   complement(1294729..1295231),complement(1294448..1294695))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000038810" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948825"
FT                   /orf_name="Pc16g05550"
FT                   /product="Pc16g05550 protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93225.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0001831CEE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H892"
FT                   /transl_table=1
FT                   /translation="MYNTPSDIWVAGAFAAVAVDFIVYPFDTLKTRVQSPDYEKVFKDA
FT                   RTGAVRRDLLFRGLYQGVWSVVFSTIPASGAFFTTYEAVKSIILRLPFTHSLPTPIMHG
FT                   IASSTGEMVSCLMITPAEVLKQNAQMIQGSQTNTSAMRQVLSRFRRHPWRLWSGYTALV
FT                   GRNLPTTALQFPLFEYVRSHLINRRRQRKANRSNTGRPPSEQSDQLVERAGLTGIAAAI
FT                   SGTVAATVTTPIDVIKTRVMLSAGEAGASSQDPISSGARTKTKSLISVGRNIVQYEGIR
FT                   GLFKGGLIRAGWTAIALGLYLSLYEGGRFYLENRRKERDLLNGKLRRPTDEGVEGL"
     MYNTPSDIWV AGAFAAVAVD FIVYPFDTLK TRVQSPDYEK VFKDARTGAV RRDLLFRGLY        60
     QGVWSVVFST IPASGAFFTT YEAVKSIILR LPFTHSLPTP IMHGIASSTG EMVSCLMITP       120
     AEVLKQNAQM IQGSQTNTSA MRQVLSRFRR HPWRLWSGYT ALVGRNLPTT ALQFPLFEYV       180
     RSHLINRRRQ RKANRSNTGR PPSEQSDQLV ERAGLTGIAA AISGTVAATV TTPIDVIKTR       240
     VMLSAGEAGA SSQDPISSGA RTKTKSLISV GRNIVQYEGI RGLFKGGLIR AGWTAIALGL       300
     YLSLYEGGRF YLENRRKERD LLNGKLRRPT DEGVEGL                                337
//

If you have problems or comments...

PBIL Back to PBIL home page