(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE556

PENCW_13.PE556       Location/Qualifiers
FT   CDS             complement(1296079..1297401)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000249874" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948826"
FT                   /orf_name="Pc16g05560"
FT                   /product="Pc16g05560 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93226.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR015904"
FT                   /db_xref="UniParc:UPI0001831CEF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H893"
FT                   /transl_table=1
FT                   /translation="MFQRRTVVAAKRSVAQWRSLATASPVSSARNHKIVVVGGGTAGLS
FT                   ISHQLLHSGKFAQDDIAVVDPAAWHNYQPGWTLVGGGLKDKQELRKPLNTLIDPKFKFY
FT                   NEGVGAFAPTENALTLENGDKINYEHLVVVPGINLNFGAIKGLSEALADRNSTVSTIYS
FT                   YDTCDKAFRNIENFHGGNAIFTQPAGVIKCAGAPQKIMWLALDHWKRAGLYNPASPSES
FT                   PVKISFATGLPMMFGVPKYSAVLEQMRKDRGVEGLFQHDLLAIDGKAAIFASPEGEVAK
FT                   QFDLLHVTPKMGAHAFVKNSALANEAGYVDVDDNTTRHKKFPNVWSAGDASSLPTSKTA
FT                   AAVTSEAPVLVRNLLQSMEGKALDASYDGYTSCPLLTEYGKVLLAEFKYAGVPKETFGD
FT                   WFGIDQAEPRRSFYHLKKDFFPWVYFNYMLKGNWAGPKGWQ"
     MFQRRTVVAA KRSVAQWRSL ATASPVSSAR NHKIVVVGGG TAGLSISHQL LHSGKFAQDD        60
     IAVVDPAAWH NYQPGWTLVG GGLKDKQELR KPLNTLIDPK FKFYNEGVGA FAPTENALTL       120
     ENGDKINYEH LVVVPGINLN FGAIKGLSEA LADRNSTVST IYSYDTCDKA FRNIENFHGG       180
     NAIFTQPAGV IKCAGAPQKI MWLALDHWKR AGLYNPASPS ESPVKISFAT GLPMMFGVPK       240
     YSAVLEQMRK DRGVEGLFQH DLLAIDGKAA IFASPEGEVA KQFDLLHVTP KMGAHAFVKN       300
     SALANEAGYV DVDDNTTRHK KFPNVWSAGD ASSLPTSKTA AAVTSEAPVL VRNLLQSMEG       360
     KALDASYDGY TSCPLLTEYG KVLLAEFKYA GVPKETFGDW FGIDQAEPRR SFYHLKKDFF       420
     PWVYFNYMLK GNWAGPKGWQ                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page