(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE58

PENCW_13.PE58        Location/Qualifiers
FT   CDS             join(complement(130406..130685),complement(130029..130352),
FT                   complement(129863..129912),complement(129619..129810))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671094"
FT                   /orf_name="Pc16g00580"
FT                   /product="Putative uncharacterized protein Pc16g00580 "
FT                   /protein_id="CAP92728.1"
FT                   /db_xref="UniParc:UPI0001831160"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W1"
FT                   /transl_table=1
FT                   /translation="MPSSKKVTKRSSDSRSLLHRILVAIYDFTGRMIDQEQLESTADEI
FT                   EKALDKNYPTLAISSLFINDIEKIIKLKWTRKDTELADLRPMECPPVLVQQIDKITRAL
FT                   GRSHPSEENGRWILNSLLLEAYEIATVICPHAAQPLNIQAERGWKYGPVKWHRRKYFLT
FT                   GRPDYGVWYGEEEAVSLNVVIVEAKRELGGMEQALGYMASNGYDFVFLKIDNDSKWSDR
FT                   KITTRDGNYDEVLGVLVHMFTKAAVMSPAHSKEPPRQQQSSGESAATKLSVQEDVEMAG
FT                   "
     MPSSKKVTKR SSDSRSLLHR ILVAIYDFTG RMIDQEQLES TADEIEKALD KNYPTLAISS        60
     LFINDIEKII KLKWTRKDTE LADLRPMECP PVLVQQIDKI TRALGRSHPS EENGRWILNS       120
     LLLEAYEIAT VICPHAAQPL NIQAERGWKY GPVKWHRRKY FLTGRPDYGV WYGEEEAVSL       180
     NVVIVEAKRE LGGMEQALGY MASNGYDFVF LKIDNDSKWS DRKITTRDGN YDEVLGVLVH       240
     MFTKAAVMSP AHSKEPPRQQ QSSGESAATK LSVQEDVEMA G                           281
//

If you have problems or comments...

PBIL Back to PBIL home page