(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE59

PENCW_13.PE59        Location/Qualifiers
FT   CDS             join(131067..131269,131330..131493,131588..131829,
FT                   131889..132059)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076650" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945529"
FT                   /orf_name="Pc16g00590"
FT                   /product="Pc16g00590 protein"
FT                   /protein_id="CAP92729.1"
FT                   /db_xref="UniParc:UPI0001831161"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W2"
FT                   /transl_table=1
FT                   /translation="MSDNTRPPQPSSLITQRSCADFQDLESFKDCLASIAQVKEHHEFV
FT                   LLDIPRDWADIVFEVLDEVVSARKMYNSRTDVLRVLTMPTAIQNCIQPWLYNQLFNWGI
FT                   TGAITPSEENMIHGEAGTKPDFLFMIRGRLLPTVAVESGWSDPMPRLQDDLNMLLVGGD
FT                   GSIKVVIIIKWSRHAPNRVSGVAELYKCDRNGIPVRDQREVIFPHNPTTGNQQLVIKRR
FT                   DLLGSGHGNPAGSLFFDLDLLRDFASRALGRMNLVPA"
     MSDNTRPPQP SSLITQRSCA DFQDLESFKD CLASIAQVKE HHEFVLLDIP RDWADIVFEV        60
     LDEVVSARKM YNSRTDVLRV LTMPTAIQNC IQPWLYNQLF NWGITGAITP SEENMIHGEA       120
     GTKPDFLFMI RGRLLPTVAV ESGWSDPMPR LQDDLNMLLV GGDGSIKVVI IIKWSRHAPN       180
     RVSGVAELYK CDRNGIPVRD QREVIFPHNP TTGNQQLVIK RRDLLGSGHG NPAGSLFFDL       240
     DLLRDFASRA LGRMNLVPA                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page