(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE6

PENCW_13.PE6         Location/Qualifiers
FT   CDS             complement(16511..17662)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076644" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945507"
FT                   /orf_name="Pc16g00060"
FT                   /product="Pc16g00060 protein"
FT                   /protein_id="CAP92676.1"
FT                   /db_xref="UniParc:UPI0001831CCE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R6"
FT                   /transl_table=1
FT                   /translation="MSDTGSGSGSRGESSRRLPAPQPQPVTQGTRLSEKTDVKWMKACT
FT                   LRVDGSNFVRWKREITNGLRMTRIENVVNFNLPKPKEDDPEYDTWYYWSVYTLGWISST
FT                   LDNEITTILEGSIQQFPEYADDLMKEITRIVSGDNKVLNVGAEVLKFDKLKRENYTTAK
FT                   DYIMAYQRQFNILGRYGVAPHPFAALYTMLHALREELPSVNFTFDTLKRQVPTETTMND
FT                   FGEYCKELIIESNTTTEETSPGLAKTTRSSSPSSSSRGGRGQRGRGGRIGRGNDWRKPK
FT                   EDNKVDDKGEAKDEPEEKQLRGAPPKGADIDEWAERQRCQQPQYINGTECTHCRLDGHP
FT                   AKACFHLMEEFVFDGWEPFPEVWCYATARMEKKDAKDAKDGKK"
     MSDTGSGSGS RGESSRRLPA PQPQPVTQGT RLSEKTDVKW MKACTLRVDG SNFVRWKREI        60
     TNGLRMTRIE NVVNFNLPKP KEDDPEYDTW YYWSVYTLGW ISSTLDNEIT TILEGSIQQF       120
     PEYADDLMKE ITRIVSGDNK VLNVGAEVLK FDKLKRENYT TAKDYIMAYQ RQFNILGRYG       180
     VAPHPFAALY TMLHALREEL PSVNFTFDTL KRQVPTETTM NDFGEYCKEL IIESNTTTEE       240
     TSPGLAKTTR SSSPSSSSRG GRGQRGRGGR IGRGNDWRKP KEDNKVDDKG EAKDEPEEKQ       300
     LRGAPPKGAD IDEWAERQRC QQPQYINGTE CTHCRLDGHP AKACFHLMEE FVFDGWEPFP       360
     EVWCYATARM EKKDAKDAKD GKK                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page