(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE60

PENCW_13.PE60        Location/Qualifiers
FT   CDS             join(132601..133028,133090..133357,133409..133659,
FT                   134166..134325,134407..134532)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945530"
FT                   /orf_name="Pc16g00600"
FT                   /product="Pc16g00600 protein"
FT                   /protein_id="CAP92730.1"
FT                   /db_xref="UniParc:UPI0001831162"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W5"
FT                   /transl_table=1
FT                   /translation="MTPTSSPSPKIKDVVVNILHTLKSIDHAHLTKSEIQRLGVSVDIF
FT                   DPNDEDSSDEDSLDPETQWLFKPISKEDIKPWKISPSEAKAVQSSLDIPELVRASQHRP
FT                   DWDVTGATQEVLHFITTQFDFRRKSKTPLRDTFGWNDIDFDEFAGGNVGLLFSIGGKFR
FT                   GVDTPGWRTGLIEEWWDGEDLAGPSVRLIICTDSNGKEGNLLLSELGSIAQVVAFRRNQ
FT                   PGFETYRLFPVLLISLFGPRHGRIIQACYDRRSNKFELRISRVFCFVTKEDAVFDTFLR
FT                   FTASYPPEIANPQFSRLARATLSQRPLAHRPARRGRDDNPMEPEAPLSEAYQDTGYYDD
FT                   MGPAYGDYDPGVRDGAFDDGGGYYDDDDRINHHVCAVRSRLFESKNKLFRHLPNCDTAA
FT                   QPAGDQAGHCR"
     MTPTSSPSPK IKDVVVNILH TLKSIDHAHL TKSEIQRLGV SVDIFDPNDE DSSDEDSLDP        60
     ETQWLFKPIS KEDIKPWKIS PSEAKAVQSS LDIPELVRAS QHRPDWDVTG ATQEVLHFIT       120
     TQFDFRRKSK TPLRDTFGWN DIDFDEFAGG NVGLLFSIGG KFRGVDTPGW RTGLIEEWWD       180
     GEDLAGPSVR LIICTDSNGK EGNLLLSELG SIAQVVAFRR NQPGFETYRL FPVLLISLFG       240
     PRHGRIIQAC YDRRSNKFEL RISRVFCFVT KEDAVFDTFL RFTASYPPEI ANPQFSRLAR       300
     ATLSQRPLAH RPARRGRDDN PMEPEAPLSE AYQDTGYYDD MGPAYGDYDP GVRDGAFDDG       360
     GGYYDDDDRI NHHVCAVRSR LFESKNKLFR HLPNCDTAAQ PAGDQAGHCR                  410
//

If you have problems or comments...

PBIL Back to PBIL home page