(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE65

PENCW_13.PE65        Location/Qualifiers
FT   CDS             join(144728..144838,144960..145038,145126..145289,
FT                   145687..145857,145967..146102,146196..146283,
FT                   146378..146438,146490..146651,146746..147063)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823848"
FT                   /orf_name="Pc16g00650"
FT                   /product="Putative uncharacterized protein Pc16g00650 "
FT                   /protein_id="CAP92735.1"
FT                   /db_xref="UniParc:UPI000183123B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W8"
FT                   /transl_table=1
FT                   /translation="MDRFHNSIPQARRASVRPIEFRYPFGFGTRYVLPTNEGRGHEDAT
FT                   VLDMAIHREGSRVTERNARVKGALRGITLLFSANGQRDIESDVTERTPWLGFALLSGFI
FT                   SANLLRMKLKQAVATFAMVPSHLKNWQDTAAFSADDNGITLESIESIESIVVMQSPFDR
FT                   YQSSLLATTFERAPGELLEIFRLLPVKVDELDMGIIKANDHYVDDVELLIDSPYLAPKD
FT                   AHGWADRCNNKCDRSGFLSRPANIGAARAPGLVVPRIDQNTSEKPNRPGLPLKVLISHF
FT                   GALGVTNKIGLSNNVFMTKLSAWLGGNGLNIFVKLGRDDQDRAVSQPSLSKKSFSRGKS
FT                   TKVPSPVPPGHLRAPQGTMTDLHSMKGNRSFTKTLSKTARTGCQSILEGSQADLQENLE
FT                   GILGVWEGTIMMILARSIHIRERAIGANWY"
     MDRFHNSIPQ ARRASVRPIE FRYPFGFGTR YVLPTNEGRG HEDATVLDMA IHREGSRVTE        60
     RNARVKGALR GITLLFSANG QRDIESDVTE RTPWLGFALL SGFISANLLR MKLKQAVATF       120
     AMVPSHLKNW QDTAAFSADD NGITLESIES IESIVVMQSP FDRYQSSLLA TTFERAPGEL       180
     LEIFRLLPVK VDELDMGIIK ANDHYVDDVE LLIDSPYLAP KDAHGWADRC NNKCDRSGFL       240
     SRPANIGAAR APGLVVPRID QNTSEKPNRP GLPLKVLISH FGALGVTNKI GLSNNVFMTK       300
     LSAWLGGNGL NIFVKLGRDD QDRAVSQPSL SKKSFSRGKS TKVPSPVPPG HLRAPQGTMT       360
     DLHSMKGNRS FTKTLSKTAR TGCQSILEGS QADLQENLEG ILGVWEGTIM MILARSIHIR       420
     ERAIGANWY                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page