(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE66

PENCW_13.PE66        Location/Qualifiers
FT   CDS             join(149167..149461,149516..149650,149707..150298,
FT                   150351..150505,150557..151233)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161421" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823849"
FT                   /orf_name="Pc16g00660"
FT                   /product="Pc16g00660 protein"
FT                   /function="transporter activity"
FT                   /biological_process="oligopeptide transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP92736.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0006857"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="UniParc:UPI000183123C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6W9"
FT                   /transl_table=1
FT                   /translation="MNASDPAEVAEIAKSKAISHNISADEKVPVVDDLTIDNAPPVRAG
FT                   SIEGDDYALEKTAPTDEELATLRRVAGKLPAAAYSVAFVELCERFSYYGTTAVFVNFIQ
FT                   RPLPDQSTTGALVPGVSDWSNESPGALGMGQQASTGLTLFNSFWSYIMPLFGAIVADQY
FT                   WGRYRTIMSAIACALVGHVILIVSAIPQVIENQKGAAACFSIGLVIMGVGTGGFKSNIS
FT                   PLIAEQYTDDRPYVTTLASGERVIVDPAATVARIYLYFYMMINIGSFVGQVAMVYAERY
FT                   VGFWLSYLLPTAMFCLCPAVLLLFKKNYVLTPPSGSIYGKALKVWGLALKGNWSLNPVR
FT                   WFQKSDKDIWAAAKPSHFGDNKPAWMDFDDAWVDEVRRGLMACRVFLWYPLYWLAYNQM
FT                   LNNLTSQAATMKLGGVPNDIINNLNPISLIVFIPIFDHIIYPGIRKMGFHFTPLKRITA
FT                   GFIMAALSMVVAAVTQHYIYKLGPCGSNANHCIEVEKQYTNISVWVQALTYIMGGISEI
FT                   LASVTSLEYAYTKAPKNMRSLVQAVALLMNAFSSAIGQAFIGLAKDPLLVWNYTVVAIL
FT                   AFVGGVGFWATNYKLDAEEDAMNMLPDSSFTPHAAEDEERK"
     MNASDPAEVA EIAKSKAISH NISADEKVPV VDDLTIDNAP PVRAGSIEGD DYALEKTAPT        60
     DEELATLRRV AGKLPAAAYS VAFVELCERF SYYGTTAVFV NFIQRPLPDQ STTGALVPGV       120
     SDWSNESPGA LGMGQQASTG LTLFNSFWSY IMPLFGAIVA DQYWGRYRTI MSAIACALVG       180
     HVILIVSAIP QVIENQKGAA ACFSIGLVIM GVGTGGFKSN ISPLIAEQYT DDRPYVTTLA       240
     SGERVIVDPA ATVARIYLYF YMMINIGSFV GQVAMVYAER YVGFWLSYLL PTAMFCLCPA       300
     VLLLFKKNYV LTPPSGSIYG KALKVWGLAL KGNWSLNPVR WFQKSDKDIW AAAKPSHFGD       360
     NKPAWMDFDD AWVDEVRRGL MACRVFLWYP LYWLAYNQML NNLTSQAATM KLGGVPNDII       420
     NNLNPISLIV FIPIFDHIIY PGIRKMGFHF TPLKRITAGF IMAALSMVVA AVTQHYIYKL       480
     GPCGSNANHC IEVEKQYTNI SVWVQALTYI MGGISEILAS VTSLEYAYTK APKNMRSLVQ       540
     AVALLMNAFS SAIGQAFIGL AKDPLLVWNY TVVAILAFVG GVGFWATNYK LDAEEDAMNM       600
     LPDSSFTPHA AEDEERK                                                      617
//

If you have problems or comments...

PBIL Back to PBIL home page