(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE67

PENCW_13.PE67        Location/Qualifiers
FT   CDS             join(153944..154439,154828..155231)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128158"
FT                   /orf_name="Pc16g00670"
FT                   /product="Putative uncharacterized protein Pc16g00670 "
FT                   /protein_id="CAP92737.1"
FT                   /db_xref="UniParc:UPI000183123D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X0"
FT                   /transl_table=1
FT                   /translation="MTDSQVTKEATAPKKSVTMTRFSAHEKEQMKSGNRTAYVALPKNV
FT                   KAKRATKNDALNKHSVPTERGSPSRVGPSPTTLGALRGSSRRRRKPSRMKYSPTRSNLV
FT                   PRKRFLIEEQMFGNTIGPRKRIVFEKPPGFTKMDVLFREFYHQVLARGLVGPVPLLPVP
FT                   AHRYKSLTMTRFSANEKEQMKAGNRTAYVALPKNLKARRASKNDALNKHIWRTYKKLEL
FT                   EAVLQSGDSYFAVVLKTPENRDRALETLRAKKVRLDSEVVSLQVMPFGVPDEAANTVWT
FT                   VRGWYGDTAEKIAGAIRT"
     MTDSQVTKEA TAPKKSVTMT RFSAHEKEQM KSGNRTAYVA LPKNVKAKRA TKNDALNKHS        60
     VPTERGSPSR VGPSPTTLGA LRGSSRRRRK PSRMKYSPTR SNLVPRKRFL IEEQMFGNTI       120
     GPRKRIVFEK PPGFTKMDVL FREFYHQVLA RGLVGPVPLL PVPAHRYKSL TMTRFSANEK       180
     EQMKAGNRTA YVALPKNLKA RRASKNDALN KHIWRTYKKL ELEAVLQSGD SYFAVVLKTP       240
     ENRDRALETL RAKKVRLDSE VVSLQVMPFG VPDEAANTVW TVRGWYGDTA EKIAGAIRT        299
//

If you have problems or comments...

PBIL Back to PBIL home page