(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE68

PENCW_13.PE68        Location/Qualifiers
FT   CDS             join(157270..157357,157411..157904,157967..158308)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161299" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945533"
FT                   /orf_name="Pc16g00680"
FT                   /product="Pc16g00680 protein"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP92738.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI000183123E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X1"
FT                   /transl_table=1
FT                   /translation="MTGPMICRVLAVLSLGMIVNASPVQLARRAISSELLERFTLFSQF
FT                   AALSACDQNINHTGQSLTCDYGTCPLVAADNTTVINAFHSDHGPTGYIALDHTRELIVL
FT                   AFRGTVSKSDGDTDLDIALTPIDEVCTGCRAHHGFWVYWSAVASQATSRLRDATSAYPG
FT                   YTLSVVGHSLGGGISALAGTVLRTQGFNLDIWTFGGPKPGNMKLAEFITNQQAPNSIYR
FT                   ATHTTDPIPKVPINLPFLDWSQPSPEYWITQATGVQVTPDGVQYVEGINSKEGNAGSDR
FT                   DLRWPNPEHGWYFGNMSACATPIDAS"
     MTGPMICRVL AVLSLGMIVN ASPVQLARRA ISSELLERFT LFSQFAALSA CDQNINHTGQ        60
     SLTCDYGTCP LVAADNTTVI NAFHSDHGPT GYIALDHTRE LIVLAFRGTV SKSDGDTDLD       120
     IALTPIDEVC TGCRAHHGFW VYWSAVASQA TSRLRDATSA YPGYTLSVVG HSLGGGISAL       180
     AGTVLRTQGF NLDIWTFGGP KPGNMKLAEF ITNQQAPNSI YRATHTTDPI PKVPINLPFL       240
     DWSQPSPEYW ITQATGVQVT PDGVQYVEGI NSKEGNAGSD RDLRWPNPEH GWYFGNMSAC       300
     ATPIDAS                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page