(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE69

PENCW_13.PE69        Location/Qualifiers
FT   CDS             complement(158480..159982)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000143616" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977037"
FT                   /orf_name="Pc16g00690"
FT                   /product="Pc16g00690 protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92739.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI000183123F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X2"
FT                   /transl_table=1
FT                   /translation="MNGLNGINENHFDVIIVGAGISGINAAYRVQDQLPGYTYTILEAR
FT                   ADLGGTWDLFKYPGIRSDSDLFTFGFQFNPWSRDNPIAEGSAIKQYVRDTAAKYGIDQH
FT                   IRYNHRLSSADWSSDENTWSLSVNHNDSEQTYTARYVIFGTGYYNYKDPLKADIPGLDA
FT                   FQGQIVHPQFWPENLQYKDKKIVIIGSGATAITLLPNLADHAARVTMLQRSPTYILSVP
FT                   NRSASRWLSYLLPNSVYCKLQRMIWIYTTRIFFLFCQRFPNFSRWLLKLNVRKQLPNHI
FT                   PYDPHFKPRYNPWDQRLCVCPDGDLFRSLRQGKADVKTDTIREVTKNGILLNSGEELDA
FT                   DIIITATGLRLQIAGGSALSVDGTKLDIGDKYLWNGVMLQDLPNASFVIGYTNASWTLG
FT                   SDATAQFICRLLKKLESQKSVAAIPRLKEKDAATLQDRPLLNLQSTYVSVAQRTLPKAA
FT                   DRGPWQPRDHYIKDLKFAQSGDIDTGLEFVQGPNLRLRPKMS"
     MNGLNGINEN HFDVIIVGAG ISGINAAYRV QDQLPGYTYT ILEARADLGG TWDLFKYPGI        60
     RSDSDLFTFG FQFNPWSRDN PIAEGSAIKQ YVRDTAAKYG IDQHIRYNHR LSSADWSSDE       120
     NTWSLSVNHN DSEQTYTARY VIFGTGYYNY KDPLKADIPG LDAFQGQIVH PQFWPENLQY       180
     KDKKIVIIGS GATAITLLPN LADHAARVTM LQRSPTYILS VPNRSASRWL SYLLPNSVYC       240
     KLQRMIWIYT TRIFFLFCQR FPNFSRWLLK LNVRKQLPNH IPYDPHFKPR YNPWDQRLCV       300
     CPDGDLFRSL RQGKADVKTD TIREVTKNGI LLNSGEELDA DIIITATGLR LQIAGGSALS       360
     VDGTKLDIGD KYLWNGVMLQ DLPNASFVIG YTNASWTLGS DATAQFICRL LKKLESQKSV       420
     AAIPRLKEKD AATLQDRPLL NLQSTYVSVA QRTLPKAADR GPWQPRDHYI KDLKFAQSGD       480
     IDTGLEFVQG PNLRLRPKMS                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page