(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE70

PENCW_13.PE70        Location/Qualifiers
FT   CDS             join(160585..160948,161013..161737)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169196" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977038"
FT                   /orf_name="Pc16g00700"
FT                   /product="Pc16g00700 protein"
FT                   /protein_id="CAP92740.1"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI0001831240"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X3"
FT                   /transl_table=1
FT                   /translation="MSITKITKVTKVKLSLKEKLDFFPAVVSIVIAYIYALLTGLRRSE
FT                   RQAKSLSLHLGYAVFRKATARLTTTQMQYILPPSHKIYERHSKKTGRLPESVELGDGAL
FT                   GHWVGDRNADNVLVWFHGGGFGLPANMGYFKFYAQLLRDLKASGKSVAVFSLTYTLAPI
FT                   AVYPTQLRQAVNCLRYILSQPNRDPATVFLGGDSAGGNLVGGVLSHLAHPHAEIDSLQL
FT                   HSNLGGAVMIAPWTLLEKDFPEIEIYHGGDIITTAVAGPWSAAYIGAGKRDYYTDLSTA
FT                   PADWFTTFPVNSVLITAGGNEIMLPLIQDFAAKFKEGFENVELFVGHRECHVAPIYHLE
FT                   LGNATKTEQGKKVEAVLAELMV"
     MSITKITKVT KVKLSLKEKL DFFPAVVSIV IAYIYALLTG LRRSERQAKS LSLHLGYAVF        60
     RKATARLTTT QMQYILPPSH KIYERHSKKT GRLPESVELG DGALGHWVGD RNADNVLVWF       120
     HGGGFGLPAN MGYFKFYAQL LRDLKASGKS VAVFSLTYTL APIAVYPTQL RQAVNCLRYI       180
     LSQPNRDPAT VFLGGDSAGG NLVGGVLSHL AHPHAEIDSL QLHSNLGGAV MIAPWTLLEK       240
     DFPEIEIYHG GDIITTAVAG PWSAAYIGAG KRDYYTDLST APADWFTTFP VNSVLITAGG       300
     NEIMLPLIQD FAAKFKEGFE NVELFVGHRE CHVAPIYHLE LGNATKTEQG KKVEAVLAEL       360
     MV                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page