(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE71

PENCW_13.PE71        Location/Qualifiers
FT   CDS             join(complement(162368..163086),complement(162027..162312))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169185" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945534"
FT                   /orf_name="Pc16g00710"
FT                   /product="Pc16g00710 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92741.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0001831241"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X4"
FT                   /transl_table=1
FT                   /translation="MSTLNLITQYTQTALSHLPEPAQDLLHHPTAQKAIGVLAALTLLR
FT                   ITNRFLSKRTLQNWTSNQPWIPARELILLTGGCSGIGKQVMEDLARTGVRVIILDINEP
FT                   TFSLPANVTFYKANITSSADIAQVANTIRENHGDPTVLVNNAGIGHEGTILDEPEEKIR
FT                   QTFEVNTLSHFLMVKEFLPAMVKANHGHVVTIASMASFVALGEIVDYCCSKASALAFHE
FT                   GLRQELKYWYNAPNVRTSVVHPFWVRTPMIKMLTDHEAHLKQPIMTPQVVSDAICKQIL
FT                   TQTSGQVILPASQSVARLVRAMPTWMQEGVRTFASGALRRMRIAQQAEKEAQA"
     MSTLNLITQY TQTALSHLPE PAQDLLHHPT AQKAIGVLAA LTLLRITNRF LSKRTLQNWT        60
     SNQPWIPARE LILLTGGCSG IGKQVMEDLA RTGVRVIILD INEPTFSLPA NVTFYKANIT       120
     SSADIAQVAN TIRENHGDPT VLVNNAGIGH EGTILDEPEE KIRQTFEVNT LSHFLMVKEF       180
     LPAMVKANHG HVVTIASMAS FVALGEIVDY CCSKASALAF HEGLRQELKY WYNAPNVRTS       240
     VVHPFWVRTP MIKMLTDHEA HLKQPIMTPQ VVSDAICKQI LTQTSGQVIL PASQSVARLV       300
     RAMPTWMQEG VRTFASGALR RMRIAQQAEK EAQA                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page