(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE72

PENCW_13.PE72        Location/Qualifiers
FT   CDS             join(163768..163887,164023..164462,164524..164908,
FT                   164986..165600)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169440" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128159"
FT                   /orf_name="Pc16g00720"
FT                   /product="Pc16g00720 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92742.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI0001831242"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X5"
FT                   /transl_table=1
FT                   /translation="MALGDSVLAVGAFTLAEAYFLQRTILTDTTFQRICLSALGGSHVE
FT                   LVFDSPRGTKPLQWMKTVPNEGLIHMRDTFNRSYVIPTNHQALLDVMSTNTYDFEKPWR
FT                   MRNFLARIIGFGMITSEGAAHKKQRKALTPAFNIKNIRSMYSLMWSKTGQLLDELEKEI
FT                   KVQPMDGTGPEDQEGKIEMSEWASRLTLDIIGPIAMGRDFGSLQNKRNKVADSFAKILE
FT                   PTKEKMAFLMMNFALPQWMARRVPWRQNDVLNAETAYLRSTCDEIVREKRASLAGSKVS
FT                   AQDLEADILGTMMLGGDFSDTELVDQMLTFLAAGHETTASALTWACYLLHLHPEYQTRL
FT                   RDEIRSKIPSGNSPITYQDLESLPLLNGVCQEVLRLYPTVPTTIRESVRNTVIAGKYIP
FT                   KGTRVVLCPWAINRSPLFWGENGEEFVPERWIDTDKNGHCIPNNNGGASTNFAQITFLH
FT                   GQRSCIGKDFARAELRCAVAGVVGRFLFEMQDPKQEIHVAGAVTIKPVEGMHLRMRRID
FT                   EW"
     MALGDSVLAV GAFTLAEAYF LQRTILTDTT FQRICLSALG GSHVELVFDS PRGTKPLQWM        60
     KTVPNEGLIH MRDTFNRSYV IPTNHQALLD VMSTNTYDFE KPWRMRNFLA RIIGFGMITS       120
     EGAAHKKQRK ALTPAFNIKN IRSMYSLMWS KTGQLLDELE KEIKVQPMDG TGPEDQEGKI       180
     EMSEWASRLT LDIIGPIAMG RDFGSLQNKR NKVADSFAKI LEPTKEKMAF LMMNFALPQW       240
     MARRVPWRQN DVLNAETAYL RSTCDEIVRE KRASLAGSKV SAQDLEADIL GTMMLGGDFS       300
     DTELVDQMLT FLAAGHETTA SALTWACYLL HLHPEYQTRL RDEIRSKIPS GNSPITYQDL       360
     ESLPLLNGVC QEVLRLYPTV PTTIRESVRN TVIAGKYIPK GTRVVLCPWA INRSPLFWGE       420
     NGEEFVPERW IDTDKNGHCI PNNNGGASTN FAQITFLHGQ RSCIGKDFAR AELRCAVAGV       480
     VGRFLFEMQD PKQEIHVAGA VTIKPVEGMH LRMRRIDEW                              519
//

If you have problems or comments...

PBIL Back to PBIL home page