(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE73

PENCW_13.PE73        Location/Qualifiers
FT   CDS             join(complement(167388..167600),complement(166819..167313),
FT                   complement(165956..166756))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203105" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671095"
FT                   /orf_name="Pc16g00730"
FT                   /product="Pc16g00730 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP92743.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831243"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X6"
FT                   /transl_table=1
FT                   /translation="MEKADSQHQHIESANSNQMESGKQCDFYVEDRITHLSEGHRQYIL
FT                   AKHGTLDLEPIPDMTDTDPYNWPQWRKNLNLTLVAFHAMMGTFTASSIQSVFENISEDL
FT                   DVSMQRTSYLVSLFIAVLGGAPLFWRPLCNRYGRRPIFLISLICSLVGNVGCAKSPSYA
FT                   TMGLCRAITAFFISPAAAIGSAVVAETFFRKDRARCMGAWTVMVTLGVPAAPFIFGFVA
FT                   LRVGYRWIYYILAIVNAVQFVLYFFFGSESLYVRSNVPPDNVIAAKRSLFRFRRIDPTP
FT                   LKLWDFFQPLIYVMKPCVIIPAVAYAMIFLWGGIVLTIEISQVYPAKFGLNTQQVGLQF
FT                   LGIIIGSVVGEQIGGFISDRWMLIRQKRTGEPSPPEYRLWLSYIGHALTICGIVVFAIE
FT                   IRDSGGAWTIAPVIGTAIGACGNQIVTTVDITYAVDCYREDAASVGVFITFVRQTWGFI
FT                   GPFWFPEMFEIVGWAGGAGIAVALIVGVSVIPTILVQWRGAGWR"
     MEKADSQHQH IESANSNQME SGKQCDFYVE DRITHLSEGH RQYILAKHGT LDLEPIPDMT        60
     DTDPYNWPQW RKNLNLTLVA FHAMMGTFTA SSIQSVFENI SEDLDVSMQR TSYLVSLFIA       120
     VLGGAPLFWR PLCNRYGRRP IFLISLICSL VGNVGCAKSP SYATMGLCRA ITAFFISPAA       180
     AIGSAVVAET FFRKDRARCM GAWTVMVTLG VPAAPFIFGF VALRVGYRWI YYILAIVNAV       240
     QFVLYFFFGS ESLYVRSNVP PDNVIAAKRS LFRFRRIDPT PLKLWDFFQP LIYVMKPCVI       300
     IPAVAYAMIF LWGGIVLTIE ISQVYPAKFG LNTQQVGLQF LGIIIGSVVG EQIGGFISDR       360
     WMLIRQKRTG EPSPPEYRLW LSYIGHALTI CGIVVFAIEI RDSGGAWTIA PVIGTAIGAC       420
     GNQIVTTVDI TYAVDCYRED AASVGVFITF VRQTWGFIGP FWFPEMFEIV GWAGGAGIAV       480
     ALIVGVSVIP TILVQWRGAG WR                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page