(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE74

PENCW_13.PE74        Location/Qualifiers
FT   CDS             join(complement(169525..169866),complement(169309..169476),
FT                   complement(169080..169253),complement(168781..169026),
FT                   complement(168345..168728))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217379" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946580"
FT                   /orf_name="Pc16g00740"
FT                   /product="Pc16g00740 protein"
FT                   /function="polygalacturonase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /biological_process="cellular cell wall organization "
FT                   /protein_id="CAP92744.1"
FT                   /db_xref="GO:0004650"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI0001831244"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6X7"
FT                   /transl_table=1
FT                   /translation="MKFLAIGALLLSTVSALATEHIIKGAQIIPASDKAGLKKIGAHGH
FT                   HKHHDRRTVTIRSSKSDTDDISDDFLWGIKAANHGGRLLLQKGKTYVIGKKLDLSFLDD
FT                   IEVQLEGEVKFTDDIDYWQANHFYYSFQRSITFWVWGGQDIKIFGKGTLNGNGQEWYNA
FT                   FAGMEILDPDNVFYRPVLFVTDNATRVSVEGITQLNSPCWTNFFVRTKDVSFDDVYINS
FT                   FSTNASALPKNTDGFDSFNVDGLRVTNTRVDVGDDCFAPKPNTTNIFVQNLWCNNTHGV
FT                   SMGSIGQYPGVEDIIEHAWIENVTLVNGQNGVRLKAWAGPDVGFGRINNITYKDVRVEN
FT                   TDSPIVLDQCYFNIDAATCAEYPSSVNFTNINFENIYGTSSGKNGKVVADLTCSPNSVC
FT                   TDIHLSDIDITSPAGGPPIVTCDGIDGDVGVECQSSSA"
     MKFLAIGALL LSTVSALATE HIIKGAQIIP ASDKAGLKKI GAHGHHKHHD RRTVTIRSSK        60
     SDTDDISDDF LWGIKAANHG GRLLLQKGKT YVIGKKLDLS FLDDIEVQLE GEVKFTDDID       120
     YWQANHFYYS FQRSITFWVW GGQDIKIFGK GTLNGNGQEW YNAFAGMEIL DPDNVFYRPV       180
     LFVTDNATRV SVEGITQLNS PCWTNFFVRT KDVSFDDVYI NSFSTNASAL PKNTDGFDSF       240
     NVDGLRVTNT RVDVGDDCFA PKPNTTNIFV QNLWCNNTHG VSMGSIGQYP GVEDIIEHAW       300
     IENVTLVNGQ NGVRLKAWAG PDVGFGRINN ITYKDVRVEN TDSPIVLDQC YFNIDAATCA       360
     EYPSSVNFTN INFENIYGTS SGKNGKVVAD LTCSPNSVCT DIHLSDIDIT SPAGGPPIVT       420
     CDGIDGDVGV ECQSSSA                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page