(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE78

PENCW_13.PE78        Location/Qualifiers
FT   CDS             complement(175996..177183)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217687" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946582"
FT                   /orf_name="Pc16g00780"
FT                   /product="Pc16g00780 protein"
FT                   /protein_id="CAP92748.1"
FT                   /db_xref="UniParc:UPI0001831248"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y1"
FT                   /transl_table=1
FT                   /translation="MDPFAKLPTEIICHILDSCCDFTSLEGLQQISPRMKEAFSGWFKN
FT                   VTETVLRNCSLTSPGLHRYFTLLASILSRSFTPQALLEELASWDHRPRRRIICLSTTHS
FT                   LAAVQQTVNIAAKIHVTACACLQHFMSRLESAEPRRPMASGVNVVDWVNGGLPPPKGGE
FT                   LIQFDVDPPSWIETYRTHRALWKLELFHQIHNAATNRWLWSTCDLNNFTKQYLKWCQCR
FT                   EGIEELPTISECVVDLCSSKPTILSHLASYLVAIPSPTDLTIQACWPLPNIQNTRVDEK
FT                   WRRSPKFRNCRNPMLRYFNVLRVTEEGRSHHALWTANFKAFRRLGIPLWDRWRLYQMKL
FT                   VGQSRSVLSPRGNLVGGGSERTEWSHGIVAYVWFSLAEEGDLSVQYIKNEDWRRQ"
     MDPFAKLPTE IICHILDSCC DFTSLEGLQQ ISPRMKEAFS GWFKNVTETV LRNCSLTSPG        60
     LHRYFTLLAS ILSRSFTPQA LLEELASWDH RPRRRIICLS TTHSLAAVQQ TVNIAAKIHV       120
     TACACLQHFM SRLESAEPRR PMASGVNVVD WVNGGLPPPK GGELIQFDVD PPSWIETYRT       180
     HRALWKLELF HQIHNAATNR WLWSTCDLNN FTKQYLKWCQ CREGIEELPT ISECVVDLCS       240
     SKPTILSHLA SYLVAIPSPT DLTIQACWPL PNIQNTRVDE KWRRSPKFRN CRNPMLRYFN       300
     VLRVTEEGRS HHALWTANFK AFRRLGIPLW DRWRLYQMKL VGQSRSVLSP RGNLVGGGSE       360
     RTEWSHGIVA YVWFSLAEEG DLSVQYIKNE DWRRQ                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page