(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE79

PENCW_13.PE79        Location/Qualifiers
FT   CDS             join(complement(181204..181800),complement(179358..181154))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169163" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977299"
FT                   /orf_name="Pc16g00790"
FT                   /product="Pc16g00790 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92749.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831313"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y2"
FT                   /transl_table=1
FT                   /translation="MENNDHSSLDHEEIESQSRTTQRRRRPPLSCTVCRKRKLKCDRSL
FT                   PCRQCVRSKTTAQCVFVGTQPGIVSDSSQRMSPPQLPYGGGEEQPGRKSGMFVFDSKLG
FT                   PNPTSNRVSKRGRSDELSELRSRLRVLETSLGKPSHLQTPETSVCDVFSEVDTANSSEN
FT                   VGVDDRVRYLPDSSFRGKKAKTRYFGRSHYTTTVSFFKDIGAFMRRDRCRGEGKDKEYT
FT                   EMKKFKTELWSRETQDHQRAFREQAFKLNEMVPQRNVADHLLQLYLDTFETTYRILHTP
FT                   TFLRQYADYWANTQPTDMAFVAQLLAVMAAGSCFYVPRPGQDDRDIFQKPAMKWIMAVQ
FT                   SYISCTFVSPDIDFRMLQTQTLLLVARLGVASDGDVAWASAGSLIRSAMTMGLHRDPTR
FT                   FRKARPFYSELRRRLWATVVELDLKISLDRGVPPSVDLDECDCDPPSNWDDSDLIPDME
FT                   NDPSPLSTALYTQNFYQTLLIKTLPLRYRIAKKINSLRFNLSYDDALRMGDELSRSIQR
FT                   ASSLFEDNAPSIAPGESGRHRFAQSIHLFIMRKFLLALHRPFSLSVVRLPKCSYSRKIC
FT                   LEESLGILSQMELPLSTEDVLYPHITQLGSGMFCDETFHAAITACVELSLQANEMSASA
FT                   TSGMDGVNSSVLMSMIQSQQGVMMQAVERTADNFGRRIGPDGKGCKPFFFLNIILASVK
FT                   SRVKGEDPLCNVDTASKRSIRICRAILNGLTYQEAKISVDNRPFQVGTSVCRYVSVIPN
FT                   VPVQTSVPSGTTPASKTPSDIDPASLLSTDFSDFTVGYCSSDAV"
     MENNDHSSLD HEEIESQSRT TQRRRRPPLS CTVCRKRKLK CDRSLPCRQC VRSKTTAQCV        60
     FVGTQPGIVS DSSQRMSPPQ LPYGGGEEQP GRKSGMFVFD SKLGPNPTSN RVSKRGRSDE       120
     LSELRSRLRV LETSLGKPSH LQTPETSVCD VFSEVDTANS SENVGVDDRV RYLPDSSFRG       180
     KKAKTRYFGR SHYTTTVSFF KDIGAFMRRD RCRGEGKDKE YTEMKKFKTE LWSRETQDHQ       240
     RAFREQAFKL NEMVPQRNVA DHLLQLYLDT FETTYRILHT PTFLRQYADY WANTQPTDMA       300
     FVAQLLAVMA AGSCFYVPRP GQDDRDIFQK PAMKWIMAVQ SYISCTFVSP DIDFRMLQTQ       360
     TLLLVARLGV ASDGDVAWAS AGSLIRSAMT MGLHRDPTRF RKARPFYSEL RRRLWATVVE       420
     LDLKISLDRG VPPSVDLDEC DCDPPSNWDD SDLIPDMEND PSPLSTALYT QNFYQTLLIK       480
     TLPLRYRIAK KINSLRFNLS YDDALRMGDE LSRSIQRASS LFEDNAPSIA PGESGRHRFA       540
     QSIHLFIMRK FLLALHRPFS LSVVRLPKCS YSRKICLEES LGILSQMELP LSTEDVLYPH       600
     ITQLGSGMFC DETFHAAITA CVELSLQANE MSASATSGMD GVNSSVLMSM IQSQQGVMMQ       660
     AVERTADNFG RRIGPDGKGC KPFFFLNIIL ASVKSRVKGE DPLCNVDTAS KRSIRICRAI       720
     LNGLTYQEAK ISVDNRPFQV GTSVCRYVSV IPNVPVQTSV PSGTTPASKT PSDIDPASLL       780
     STDFSDFTVG YCSSDAV                                                      797
//

If you have problems or comments...

PBIL Back to PBIL home page